Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Families
- Secreted Protein
Filter by
Target Symbol
- LGALS3 (72)
- LOX (53)
- AGR2 (50)
- F13A1 (45)
- SYP (37)
- EGFR (33)
- SYT4 (27)
- SIL1 (25)
- TIMP2 (23)
- CPA2 (21)
- WNT3 (21)
- FGG (20)
- ERBB3 (19)
- FN1 (18)
- FGFR2 (17)
- NTF3 (16)
- NOG (15)
- RNPEP (15)
- IGF1 (12)
- LOXL2 (12)
- VEGFB (12)
- RSPO1 (11)
- RSPO3 (11)
- SERPINE2 (11)
- POSTN (10)
- SFRP2 (10)
- ANGPT2 (8)
- ANGPT1 (7)
- BDNF (7)
- FGF2 (7)
- NTF4 (7)
- TGFBI (7)
- ANGPTL1 (6)
- CHGA (6)
- GCG (6)
- GNAS (6)
- LAMA4 (6)
- VEGFC (6)
- ADAMTS4 (5)
- AMY2B (5)
- BMP4 (5)
- CALR (5)
- CANT1 (5)
- DPP4 (5)
- FGF13 (5)
- GDF15 (5)
- IL17B (5)
- LAMB2 (5)
- LY96 (5)
- RAB37 (5)
- SHH (5)
- ACE2 (4)
- ADIPOQ (4)
- ADM (4)
- AFP (4)
- CCL2 (4)
- DEFA1 (4)
- EDA (4)
- EIF2AK3 (4)
- MUC1 (4)
- TAC1 (4)
- TNFSF13 (4)
- TTR (4)
- VEGFA (4)
- AGR3 (3)
- AGT (3)
- ANGPTL4 (3)
- BMP3 (3)
- CCL17 (3)
- CD5L (3)
- CXCL12 (3)
- DCN (3)
- EPOR (3)
- GSN (3)
- IL1RL1 (3)
- IL20 (3)
- INHBA (3)
- KL (3)
- LEP (3)
- MANF (3)
- PLXDC1 (3)
- PROS1 (3)
- PTHLH (3)
- SERPINA1 (3)
- SERPINA3 (3)
- SERPINB5 (3)
- SERPINC1 (3)
- SFRP1 (3)
- SHBG (3)
- SPATA6 (3)
- SPP1 (3)
- SYT5 (3)
- TFF3 (3)
- TGFB1 (3)
- TIMP4 (3)
- TNC (3)
- TNF (3)
- TNFRSF11B (3)
- TNXB (3)
- VGF (3)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (224)
- Cytokine-cytokine receptor interaction (161)
- MAPK signaling pathway (122)
- Focal adhesion (119)
- Regulation of actin cytoskeleton (96)
- Complement and coagulation cascades (95)
- Endocytosis (73)
- Melanoma (68)
- Wnt signaling pathway (68)
- Prostate cancer (67)
- Pancreatic cancer (66)
- Hedgehog signaling pathway (64)
- Basal cell carcinoma (63)
- Bladder cancer (59)
- Calcium signaling pathway (58)
- Melanogenesis (58)
- ErbB signaling pathway (56)
- ECM-receptor interaction (50)
- Glioma (47)
- TGF-beta signaling pathway (46)
- GnRH signaling pathway (42)
- Colorectal cancer (40)
- Gap junction (39)
- mTOR signaling pathway (37)
- Jak-STAT signaling pathway (36)
- Non-small cell lung cancer (35)
- Small cell lung cancer (34)
- Adherens junction (33)
- Dorso-ventral axis formation (33)
- Endometrial cancer (33)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- Neurotrophin signaling pathway (33)
- Renal cell carcinoma (33)
- Dilated cardiomyopathy (28)
- Hypertrophic cardiomyopathy (HCM) (23)
- p53 signaling pathway (21)
- Long-term depression (20)
- Hematopoietic cell lineage (19)
- Toll-like receptor signaling pathway (18)
- Chemokine signaling pathway (17)
- Adipocytokine signaling pathway (16)
- Metabolic pathways (14)
- Alzheimer's disease (13)
- Neuroactive ligand-receptor interaction (13)
- Oocyte meiosis (13)
- PPAR signaling pathway (13)
- Progesterone-mediated oocyte maturation (13)
- Apoptosis (12)
- NOD-like receptor signaling pathway (12)
- Antigen processing and presentation (10)
- Axon guidance (10)
- Type I diabetes mellitus (10)
- Allograft rejection (9)
- Cell cycle (9)
- Natural killer cell mediated cytotoxicity (9)
- Graft-versus-host disease (8)
- Renin-angiotensin system (8)
- Type II diabetes mellitus (8)
- Asthma (7)
- Autoimmune thyroid disease (7)
- Chronic myeloid leukemia (7)
- Cytosolic DNA-sensing pathway (7)
- Huntington's disease (7)
- RIG-I-like receptor signaling pathway (7)
- Systemic lupus erythematosus (7)
- Vascular smooth muscle contraction (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Purine metabolism (6)
- Pyrimidine metabolism (6)
- Starch and sucrose metabolism (6)
- T cell receptor signaling pathway (6)
- Taste transduction (6)
- Vibrio cholerae infection (6)
- Fc epsilon RI signaling pathway (5)
- Fc gamma R-mediated phagocytosis (5)
- Pathogenic Escherichia coli infection (5)
- VEGF signaling pathway (5)
- Regulation of autophagy (4)
- SNARE interactions in vesicular transport (4)
- Cell adhesion molecules (CAMs) (3)
- Leukocyte transendothelial migration (3)
- Primary immunodeficiency (3)
- Prion diseases (3)
- Ether lipid metabolism (2)
- Maturity onset diabetes of the young (2)
- Viral myocarditis (2)
- Acute myeloid leukemia (1)
- Arachidonic acid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Histidine metabolism (1)
- Insulin signaling pathway (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- O-Glycan biosynthesis (1)
- Proteasome (1)
- Tyrosine metabolism (1)
- alpha-Linolenic acid metabolism (1)
- beta-Alanine metabolism (1)