Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Cell cycle
Filter by
Category
Target Symbol
- TP53 (95)
- CDKN2A (57)
- PCNA (47)
- MCM2 (33)
- BUB1B (32)
- MDM2 (29)
- GADD45G (23)
- CHEK2 (22)
- SMC1A (18)
- PLK1 (17)
- RB1 (17)
- ANAPC11 (15)
- CDKN1A (15)
- HDAC2 (15)
- MYC (13)
- CDC6 (11)
- CDKN2B (10)
- SMAD3 (8)
- GSK3B (7)
- CCNB1 (6)
- CCNE1 (6)
- CDC25A (6)
- CDK1 (6)
- HDAC1 (6)
- RAD21 (6)
- ANAPC1 (5)
- CCNA1 (5)
- CDK6 (5)
- CDK7 (5)
- PKMYT1 (5)
- ABL1 (4)
- ANAPC2 (4)
- CCND3 (4)
- CDC16 (4)
- CDKN1C (4)
- MCM3 (4)
- MCM6 (4)
- MCM7 (4)
- SFN (4)
- SMAD4 (4)
- TGFB1 (4)
- YWHAB (4)
- YWHAE (4)
- YWHAZ (4)
- ANAPC10 (3)
- ATM (3)
- CCND1 (3)
- CDC20 (3)
- CDC25B (3)
- CDC25C (3)
- CDC45 (3)
- CDK4 (3)
- CDKN2C (3)
- CREBBP (3)
- CUL1 (3)
- E2F4 (3)
- EP300 (3)
- MAD2L1 (3)
- MCM5 (3)
- PRKDC (3)
- TFDP1 (3)
- TGFB3 (3)
- YWHAG (3)
- YWHAQ (3)
- ANAPC4 (2)
- ANAPC5 (2)
- BUB1 (2)
- CCNB2 (2)
- CCND2 (2)
- CCNE2 (2)
- CCNH (2)
- CDC27 (2)
- CDC7 (2)
- CDK2 (2)
- CDKN1B (2)
- E2F1 (2)
- GADD45A (2)
- GADD45B (2)
- PTTG1 (2)
- RBL2 (2)
- SKP1 (2)
- SMAD2 (2)
- TFDP2 (2)
- TGFB2 (2)
- ANAPC13 (1)
- ANAPC7 (1)
- ATR (1)
- CCNA2 (1)
- CDC2 (1)
- CDC23 (1)
- CDKN2D (1)
- CHEK1 (1)
- DCLRE1C (1)
- E2F2 (1)
- E2F3 (1)
- ESPL1 (1)
- MAD1L1 (1)
- MAD2L2 (1)
- MCM4 (1)
- ORC2 (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (668)
- Stem cell - Pluripotency (322)
- Transcription Factors (283)
- Protein Kinase (122)
- Stem cell relevant signaling - JAK/STAT signaling pathway (26)
- Embryonic stem cells (23)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (23)
- Stem cell relevant signaling - Wnt Signaling pathway (16)
- Stem cell relevant signaling - DSL/Notch pathway (15)
- ES Cell Differentiation/IPS (14)
- Induced pluripotent stem cells (13)
- Secreted Protein (13)
- Phosphatase (12)
- Cancer stem cells (10)
- Adult stem cells (6)
- Transmembrane (5)
- Protease (1)