Germany
Japan
United Kingdom
China
Antibodies
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
USD 399.00
In Stock
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
Rabbit Polyclonal TET1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
USD 380.00
2 Weeks
Active filters
Reactivities
- Human
Applications
- IHC
Filter by
Target Symbol
- MAP2K1 (179)
- TP53 (148)
- MKI67 (145)
- NME1 (134)
- KRT19 (130)
- MSMB (123)
- OTC (118)
- LIPG (117)
- TG (116)
- KLK8 (114)
- ERBB2 (113)
- PECAM1 (112)
- NBN (110)
- PGR (107)
- MAP2K3 (99)
- CTAG1B (97)
- CDKN2A (94)
- CD4 (91)
- ABCB1 (88)
- CD99 (82)
- ADIPOQ (81)
- AKT1 (78)
- CHGA (78)
- PCNA (77)
- CTNNB1 (76)
- JUN (75)
- LGALS3 (75)
- ERCC1 (74)
- APP (72)
- NKX3-1 (72)
- PIK3C2A (72)
- VSNL1 (72)
- TOP2A (69)
- KRT20 (66)
- BCL2 (65)
- PTPRC (65)
- SENP2 (64)
- MLANA (62)
- NCAM1 (62)
- CD68 (61)
- MS4A1 (59)
- S100A9 (58)
- BSG (57)
- EPCAM (57)
- MEF2C (57)
- CD44 (56)
- MDM4 (56)
- PIK3CG (56)
- ABAT (55)
- KIT (55)
- AGR2 (54)
- BBOX1 (54)
- CDH1 (54)
- LOX (54)
- MGLL (54)
- PDCD1 (54)
- RTRAF (54)
- TYMP (54)
- EGFR (53)
- KRT18 (53)
- MCM2 (53)
- PFKP (53)
- VBP1 (53)
- BTK (52)
- CTSL (52)
- LTA4H (52)
- MGMT (52)
- NPR3 (52)
- PDE4A (52)
- POR (52)
- PPP5C (52)
- PROCR (52)
- UBE2G2 (52)
- BUB1B (51)
- ESR1 (51)
- KRT7 (51)
- MUC1 (51)
- TYMS (51)
- AKR1A1 (50)
- F13A1 (50)
- GBP2 (50)
- LPIN1 (50)
- PARVA (50)
- SQSTM1 (50)
- NAPSA (49)
- RET (49)
- AMACR (48)
- CD63 (48)
- MTOR (48)
- PTPRE (48)
- ACAT2 (47)
- GCH1 (47)
- HSPD1 (47)
- NME4 (47)
- NR3C1 (47)
- TNFRSF8 (47)
- BHLHE41 (46)
- FCGR2A (46)
- STAT4 (46)
- CR2 (45)
Antibody Hosts
Isotypes
- IgG (22901)
- IgG1 (18639)
- IgG2a (5321)
- IgG2b (4653)
- IgG1, kappa (226)
- Ig (133)
- IgG, kappa (93)
- IgG3 (88)
- IgG2a, kappa (56)
- IgG2b, kappa (49)
- IgM (13)
- IgY (11)
- IgG3, kappa (10)
- IgM, kappa (9)
- IgG1, lambda (8)
- IgG2c (5)
- Fab fragment, kappa (2)
- IgG2 (2)
- F(ab)2, kappa (1)
- IgG fraction (1)
- IgG1/IgK (1)
- IgG12b (1)
- IgG2, kappa (1)
- IgG2a, lambda (1)
- IgG2b, lambda (1)
- IgG4 (1)
- cocktail (1)
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (2309)
- Phospho-specific (462)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (33)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (7)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K5 (2)
- Phospho S127 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (2)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- This full-length, reformatted human antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan DiMethyl-lysine (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S104 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S182 (1)
- Phospho S240/244 (1)
- Phospho S243 (1)
- Phospho S280 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S37 (1)
- Phospho S376 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S5 (1)
- Phospho S51 (1)
- Phospho S529 (1)
- Phospho S612 (1)
- Phospho S62 (1)
- Phospho S73 (1)
- Phospho S80 (1)
- Phospho S82 (1)
- Phospho S89 (1)
- Phospho S957 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T17 (1)
- Phospho T179 (1)
- Phospho T18/S19 (1)
- Phospho T183/T172 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T286 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T37/46 (1)
- Phospho T389 (1)
- Phospho T45 (1)
- Phospho T58 (1)
- Phospho T6 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T91 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1217 (1)
- Phospho Y1349 (1)
- Phospho Y15 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y245 (1)
- Phospho Y412 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This is a chimeric mouse antibody, based on the original rat IgG2b format, created for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- phospho T1079,Phospho T1041 (1)
Assay Types
Families
- Druggable Genome (24525)
- Transmembrane (8608)
- Transcription Factors (5859)
- Secreted Protein (3845)
- ES Cell Differentiation/IPS (3219)
- Protein Kinase (2697)
- Protease (1847)
- Stem cell - Pluripotency (1795)
- Adult stem cells (696)
- GPCR (557)
- Nuclear Hormone Receptor (465)
- Embryonic stem cells (446)
- Phosphatase (372)
- Cancer stem cells (333)
- P450 (269)
- Induced pluripotent stem cells (259)
- Stem cell relevant signaling - DSL/Notch pathway (201)
- Stem cell relevant signaling - JAK/STAT signaling pathway (196)
- Ion Channels: Other (185)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (101)
- Ion Channels: Transient receptor potential (79)
- Ion Channels: Potassium (77)
- Stem cell relevant signaling - Wnt Signaling pathway (67)
- Ion Channels: Cys-loop Receptors (48)
- Ion Channels: Glutamate Receptors (32)
- Ion Channels: Sodium (22)
- Ion Channels: Calcium (10)
- Ion Channels: Cyclic nucleotide gated (10)
- Ion Channels: ATP Receptors (8)
Pathways
- Metabolic pathways (4338)
- Pathways in cancer (3081)
- MAPK signaling pathway (1780)
- Focal adhesion (1604)
- Prostate cancer (1505)
- Colorectal cancer (1270)
- Neurotrophin signaling pathway (1264)
- T cell receptor signaling pathway (1214)
- Toll-like receptor signaling pathway (1196)
- Pancreatic cancer (1172)
- ErbB signaling pathway (1150)
- Melanoma (1137)
- Chronic myeloid leukemia (1136)
- Regulation of actin cytoskeleton (1099)
- Endometrial cancer (1095)
- Glioma (1068)
- Cell adhesion molecules (CAMs) (1066)
- Insulin signaling pathway (1051)
- Non-small cell lung cancer (1047)
- B cell receptor signaling pathway (1028)
- Bladder cancer (1024)
- Cell cycle (972)
- Progesterone-mediated oocyte maturation (972)
- Cytokine-cytokine receptor interaction (949)
- Chemokine signaling pathway (948)
- Apoptosis (946)
- Acute myeloid leukemia (907)
- Fc epsilon RI signaling pathway (870)
- Fc gamma R-mediated phagocytosis (863)
- Hematopoietic cell lineage (861)
- Renal cell carcinoma (838)
- Leukocyte transendothelial migration (814)
- Small cell lung cancer (806)
- Wnt signaling pathway (805)
- Endocytosis (780)
- Jak-STAT signaling pathway (777)
- Natural killer cell mediated cytotoxicity (763)
- Alzheimer's disease (752)
- GnRH signaling pathway (721)
- p53 signaling pathway (717)
- VEGF signaling pathway (699)
- Huntington's disease (677)
- Melanogenesis (669)
- Thyroid cancer (656)
- Oocyte meiosis (653)
- Amyotrophic lateral sclerosis (ALS) (639)
- Purine metabolism (632)
- Adherens junction (610)
- Gap junction (599)
- Calcium signaling pathway (581)
- Adipocytokine signaling pathway (571)
- Pyrimidine metabolism (546)
- Neuroactive ligand-receptor interaction (541)
- mTOR signaling pathway (537)
- Type II diabetes mellitus (527)
- Ubiquitin mediated proteolysis (525)
- Vascular smooth muscle contraction (497)
- Glycolysis / Gluconeogenesis (470)
- Parkinson's disease (468)
- Long-term potentiation (442)
- Pathogenic Escherichia coli infection (440)
- Long-term depression (438)
- Prion diseases (436)
- Tight junction (435)
- Basal cell carcinoma (433)
- Arginine and proline metabolism (418)
- Primary immunodeficiency (415)
- Complement and coagulation cascades (414)
- Lysosome (413)
- Axon guidance (410)
- Epithelial cell signaling in Helicobacter pylori infection (403)
- Antigen processing and presentation (376)
- RIG-I-like receptor signaling pathway (363)
- Valine (357)
- leucine and isoleucine degradation (352)
- TGF-beta signaling pathway (348)
- Systemic lupus erythematosus (340)
- Glycerolipid metabolism (339)
- Drug metabolism - cytochrome P450 (331)
- Metabolism of xenobiotics by cytochrome P450 (320)
- PPAR signaling pathway (318)
- Nucleotide excision repair (317)
- Phosphatidylinositol signaling system (314)
- NOD-like receptor signaling pathway (313)
- Oxidative phosphorylation (311)
- Dilated cardiomyopathy (309)
- Dorso-ventral axis formation (309)
- ECM-receptor interaction (302)
- Fatty acid metabolism (302)
- Hypertrophic cardiomyopathy (HCM) (290)
- Tryptophan metabolism (287)
- Cytosolic DNA-sensing pathway (281)
- Arachidonic acid metabolism (276)
- Autoimmune thyroid disease (275)
- Inositol phosphate metabolism (258)
- Lysine degradation (258)
- Viral myocarditis (252)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (251)
- Spliceosome (251)
- DNA replication (245)
- Alanine (243)
- aspartate and glutamate metabolism (243)
- Propanoate metabolism (239)
- Butanoate metabolism (238)
- RNA degradation (233)
- Type I diabetes mellitus (227)
- Mismatch repair (226)
- Glutathione metabolism (223)
- Tyrosine metabolism (222)
- Hedgehog signaling pathway (220)
- Base excision repair (219)
- Pyruvate metabolism (216)
- Retinol metabolism (214)
- Histidine metabolism (212)
- Glycine (192)
- serine and threonine metabolism (192)
- Notch signaling pathway (187)
- Renin-angiotensin system (180)
- Proteasome (175)
- ABC transporters (173)
- Cardiac muscle contraction (173)
- Homologous recombination (172)
- One carbon pool by folate (172)
- Allograft rejection (171)
- beta-Alanine metabolism (162)
- Starch and sucrose metabolism (157)
- Vibrio cholerae infection (156)
- Pentose phosphate pathway (152)
- Graft-versus-host disease (149)
- Cysteine and methionine metabolism (145)
- Drug metabolism - other enzymes (142)
- Amino sugar and nucleotide sugar metabolism (139)
- Fructose and mannose metabolism (139)
- Linoleic acid metabolism (129)
- Citrate cycle (TCA cycle) (122)
- Circadian rhythm - mammal (115)
- Nicotinate and nicotinamide metabolism (115)
- Regulation of autophagy (114)
- Terpenoid backbone biosynthesis (111)
- Maturity onset diabetes of the young (110)
- Galactose metabolism (108)
- Sphingolipid metabolism (103)
- Primary bile acid biosynthesis (94)
- Aminoacyl-tRNA biosynthesis (93)
- Fatty acid elongation in mitochondria (93)
- Folate biosynthesis (93)
- Nitrogen metabolism (92)
- Ribosome (92)
- Glycerophospholipid metabolism (91)
- SNARE interactions in vesicular transport (87)
- N-Glycan biosynthesis (86)
- Caffeine metabolism (81)
- Sulfur metabolism (81)
- Asthma (77)
- Taste transduction (76)
- Porphyrin and chlorophyll metabolism (72)
- Synthesis and degradation of ketone bodies (71)
- Non-homologous end-joining (70)
- Phenylalanine metabolism (70)
- Other glycan degradation (65)
- Androgen and estrogen metabolism (60)
- Selenoamino acid metabolism (57)
- Methane metabolism (56)
- Glyoxylate and dicarboxylate metabolism (54)
- Olfactory transduction (49)
- RNA polymerase (49)
- Glycosaminoglycan degradation (45)
- Biosynthesis of unsaturated fatty acids (44)
- Ascorbate and aldarate metabolism (41)
- Limonene and pinene degradation (39)
- Pantothenate and CoA biosynthesis (39)
- Basal transcription factors (37)
- Cyanoamino acid metabolism (36)
- Ether lipid metabolism (34)
- Pentose and glucuronate interconversions (32)
- Riboflavin metabolism (29)
- Steroid biosynthesis (29)
- Taurine and hypotaurine metabolism (29)
- Fatty acid biosynthesis (27)
- Vitamin B6 metabolism (25)
- C21-Steroid hormone metabolism (24)
- O-Glycan biosynthesis (24)
- Glycosphingolipid biosynthesis - ganglio series (23)
- D-Glutamine and D-glutamate metabolism (19)
- Glycosphingolipid biosynthesis - lacto and neolacto series (18)
- Keratan sulfate biosynthesis (16)
- Thiamine metabolism (14)
- leucine and isoleucine biosynthesis (13)
- Chondroitin sulfate biosynthesis (11)
- Glycosphingolipid biosynthesis - globo series (11)
- Protein export (9)
- alpha-Linolenic acid metabolism (9)
- Heparan sulfate biosynthesis (8)
- Phenylalanine (7)
- tyrosine and tryptophan biosynthesis (7)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Biotin metabolism (5)
- Lysine biosynthesis (3)
- O-Mannosyl glycan biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)