Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
PAH Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PAH |
EXT1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EXT1 |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Anti-ADH5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Pathways
- Metabolic pathways
Filter by
Category
Target Symbol
- GAPDH (17)
- TH (14)
- NOS3 (11)
- PLCG1 (10)
- ALDOA (7)
- ALOX5 (7)
- GAD1 (7)
- PLCG2 (7)
- AKR1A1 (6)
- AKR1B1 (6)
- NOS2 (6)
- PKM (6)
- ACACA (5)
- ALDH1A1 (5)
- AOX1 (5)
- BHMT (5)
- ENO2 (5)
- GAD2 (5)
- GLUL (5)
- GOT2 (5)
- HSD17B10 (5)
- IDH2 (5)
- NDUFS1 (5)
- PC (5)
- PCK1 (5)
- PTGDS (5)
- TPH2 (5)
- ACAT1 (4)
- ACO1 (4)
- ACO2 (4)
- AGXT (4)
- ALDH1A2 (4)
- ALDH2 (4)
- ALDH3A1 (4)
- ALDH5A1 (4)
- ALDH6A1 (4)
- ALDH9A1 (4)
- ALDOB (4)
- ALPL (4)
- AMD1 (4)
- CAT (4)
- COX5B (4)
- CYP19A1 (4)
- DGAT1 (4)
- DNMT3A (4)
- ENO1 (4)
- GOT1 (4)
- GPT (4)
- HK1 (4)
- NFKB1 (4)
- NME2 (4)
- NOS1 (4)
- NT5E (4)
- PDHA1 (4)
- PIK3C3 (4)
- PLA2G4A (4)
- POLR2G (4)
- PON2 (4)
- PRDX6 (4)
- SPHK1 (4)
- TPH1 (4)
- AASDHPPT (3)
- ACOX2 (3)
- ACY1 (3)
- ADA (3)
- ADH1A (3)
- ADH1B (3)
- ADH5 (3)
- AK1 (3)
- AK4 (3)
- ALDH3B1 (3)
- ALDH4A1 (3)
- ASAH1 (3)
- ASNS (3)
- CKM (3)
- COX4I2 (3)
- CYP2E1 (3)
- CYP3A4 (3)
- DNMT1 (3)
- DNMT3B (3)
- FASN (3)
- FH (3)
- FTCD (3)
- G6PD (3)
- GCH1 (3)
- GCK (3)
- GGT1 (3)
- GK (3)
- GLS (3)
- GLUD1 (3)
- GNE (3)
- HDC (3)
- HK2 (3)
- HPRT1 (3)
- HPSE (3)
- IDH1 (3)
- MAOB (3)
- MDH1 (3)
- NAT1 (3)
- NDUFS6 (3)