Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-NP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Rabbit Polyclonal Anti-PKM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ |
Rabbit Polyclonal Anti-PAPSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Rabbit Polyclonal Anti-PKLR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BACE1 |
USD 525.00
5 Days
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit polyclonal anti-PDE3B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-ADK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADK |
ADK (22-362) mouse monoclonal antibody, clone AT4F8, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
ADK (22-362) mouse monoclonal antibody, clone AT4F8, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
USD 480.00
2 Weeks
Natriuretic Peptide Receptor B (NPR2) (131-231) mouse monoclonal antibody, clone 2A6, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Active filters
Families
- Druggable Genome
Pathways
- Purine metabolism
Filter by
Target Symbol
- NME1 (177)
- PDE4A (56)
- RRM1 (56)
- NME4 (55)
- PPAT (51)
- AK4 (49)
- AK5 (47)
- PDE2A (47)
- PKLR (44)
- AK1 (35)
- PDE4B (35)
- PAPSS2 (31)
- DCK (26)
- HPRT1 (25)
- PAICS (23)
- PDE6G (21)
- PDE10A (20)
- PDE1B (20)
- NUDT9 (19)
- PDE1A (18)
- PKM (18)
- RRM2 (14)
- GUK1 (13)
- XDH (13)
- IMPDH2 (11)
- NME2 (9)
- PDE4D (9)
- ENPP3 (8)
- PDE3B (8)
- ADSL (7)
- GMPR (7)
- NPR1 (7)
- ADA (6)
- PRPS1L1 (6)
- PRPS2 (6)
- ADK (5)
- NPR2 (5)
- PDE7B (5)
- PDE9A (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- AMPD2 (4)
- APRT (4)
- GUCY1B1 (4)
- PDE11A (4)
- PDE3A (4)
- POLD1 (4)
- PRPS1 (4)
- ADCY2 (3)
- ADCY6 (3)
- AK2 (3)
- AMPD1 (3)
- IMPDH1 (3)
- PDE1C (3)
- PDE4C (3)
- PDE5A (3)
- PDE7A (3)
- PDE8A (3)
- PDE8B (3)
- POLA1 (3)
- POLR2C (3)
- PRIM1 (3)
- RRM2B (3)
- ADCY3 (2)
- ADCY8 (2)
- ENPP1 (2)
- GUCY1A1 (2)
- ITPA (2)
- NME3 (2)
- NME5 (2)
- PNP (2)
- POLR1C (2)
- ADCY10 (1)
- ADCY7 (1)
- ADCY9 (1)
- AK7 (1)
- AMPD3 (1)
- DGUOK (1)
- GMPR2 (1)
- GUCY1A2 (1)
- GUCY1A3 (1)
- GUCY1B3 (1)
- GUCY2D (1)
- NME6 (1)
- NME7 (1)
- PAPSS1 (1)
- POLE (1)