Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Active filters
Isotypes
- IgG
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- AKT1 (51)
- EGFR (51)
- JUN (26)
- CTNNB1 (24)
- BCL2 (23)
- GAPDH (22)
- KDR (21)
- CASP3 (20)
- SMAD1 (20)
- SMAD3 (20)
- SMAD2 (17)
- STAT6 (17)
- ACTB (16)
- BCL2L1 (16)
- CD44 (15)
- CDH1 (15)
- KIT (14)
- PDGFRB (14)
- MAPK8 (13)
- SOX2 (13)
- SRC (13)
- STAT5A (13)
- STAT5B (13)
- GATA6 (12)
- GCG (12)
- MYB (12)
- PRKCA (12)
- RUNX1 (12)
- CXCL12 (11)
- FOXA2 (11)
- GATA1 (11)
- HNF4A (11)
- ICAM1 (11)
- ITGB3 (11)
- MAPK3 (11)
- NOTCH1 (11)
- PECAM1 (11)
- BDNF (10)
- FN1 (10)
- GFAP (10)
- HNF1B (10)
- MKI67 (10)
- VIM (10)
- CCR5 (9)
- CD70 (9)
- CDH5 (9)
- CEBPA (9)
- CEBPB (9)
- FGF4 (9)
- HCRTR1 (9)
- HNF1A (9)
- NANOG (9)
- SOX1 (9)
- SOX9 (9)
- TCF7 (9)
- TNNI3 (9)
- YBX1 (9)
- CDX2 (8)
- CXCR4 (8)
- CYP3A4 (8)
- EGF (8)
- GATA3 (8)
- IGF1 (8)
- ITGAV (8)
- KLF4 (8)
- NEUROD1 (8)
- SP1 (8)
- TCF3 (8)
- TGFB1 (8)
- AKT2 (7)
- DLL4 (7)
- FAS (7)
- FOXA1 (7)
- IGFBP1 (7)
- JMJD6 (7)
- MST1R (7)
- NES (7)
- PDGFRA (7)
- SERPINA1 (7)
- TEK (7)
- TNC (7)
- VCAM1 (7)
- ACTN1 (6)
- ALDH1A1 (6)
- ANPEP (6)
- BMI1 (6)
- BSG (6)
- BTC (6)
- CDH2 (6)
- CSF1 (6)
- DLX5 (6)
- FLT3 (6)
- G6PC1 (6)
- GATA4 (6)
- ID4 (6)
- ITGA4 (6)
- ITGB1 (6)
- LEF1 (6)
- MAP2 (6)
- MAPK6 (6)
Reactivities
- Human (1749)
- Mouse (1090)
- Rat (891)
- Dog (55)
- Monkey (39)
- Pig (39)
- Bovine (33)
- Cow (28)
- Chicken (26)
- Canine (19)
- Rabbit (18)
- Zebrafish (16)
- Xenopus (10)
- Gorilla (8)
- Drosophila (7)
- Gibbon (6)
- Primate (5)
- X. tropicalis (5)
- Bat (4)
- Feline (4)
- Horse (4)
- Chimpanzee (3)
- Hamster (3)
- Rhesus Monkey (3)
- All Species (2)
- Goat (2)
- Guinea Pig (2)
- Macaque (2)
- Porcine (2)
- Sheep (2)
- Canis (1)
- Opossum (1)
- Orang-Utan (1)
- Quail (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (598)
- Focal adhesion (395)
- Colorectal cancer (337)
- MAPK signaling pathway (281)
- Cytokine-cytokine receptor interaction (256)
- ErbB signaling pathway (235)
- Prostate cancer (234)
- Wnt signaling pathway (214)
- Melanoma (213)
- Pancreatic cancer (213)
- Regulation of actin cytoskeleton (211)
- Endometrial cancer (197)
- Adherens junction (196)
- Glioma (176)
- Jak-STAT signaling pathway (175)
- Acute myeloid leukemia (167)
- Chronic myeloid leukemia (158)
- Neurotrophin signaling pathway (152)
- Endocytosis (147)
- Non-small cell lung cancer (147)
- Leukocyte transendothelial migration (145)
- TGF-beta signaling pathway (143)
- Hematopoietic cell lineage (142)
- Small cell lung cancer (139)
- Tight junction (139)
- Cell adhesion molecules (CAMs) (136)
- GnRH signaling pathway (132)
- Apoptosis (131)
- T cell receptor signaling pathway (131)
- Epithelial cell signaling in Helicobacter pylori infection (127)
- Gap junction (125)
- Melanogenesis (123)
- Toll-like receptor signaling pathway (122)
- VEGF signaling pathway (122)
- Renal cell carcinoma (121)
- Chemokine signaling pathway (117)
- Basal cell carcinoma (113)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (110)
- Fc epsilon RI signaling pathway (110)
- B cell receptor signaling pathway (109)
- Insulin signaling pathway (106)
- Progesterone-mediated oocyte maturation (104)
- Fc gamma R-mediated phagocytosis (102)
- Adipocytokine signaling pathway (96)
- Calcium signaling pathway (88)
- Hypertrophic cardiomyopathy (HCM) (88)
- mTOR signaling pathway (87)
- Bladder cancer (85)
- Dilated cardiomyopathy (84)
- ECM-receptor interaction (83)
- Natural killer cell mediated cytotoxicity (81)
- Pathogenic Escherichia coli infection (80)
- Hedgehog signaling pathway (79)
- Dorso-ventral axis formation (73)
- Maturity onset diabetes of the young (72)
- Metabolic pathways (68)
- Thyroid cancer (65)
- Alzheimer's disease (63)
- Amyotrophic lateral sclerosis (ALS) (61)
- Viral myocarditis (52)
- Cell cycle (45)
- Notch signaling pathway (44)
- Type II diabetes mellitus (43)
- Huntington's disease (38)
- Axon guidance (37)
- p53 signaling pathway (35)
- Glycolysis / Gluconeogenesis (32)
- Long-term depression (31)
- Prion diseases (31)
- NOD-like receptor signaling pathway (28)
- Vibrio cholerae infection (28)
- Long-term potentiation (23)
- Vascular smooth muscle contraction (23)
- Oocyte meiosis (22)
- RIG-I-like receptor signaling pathway (21)
- Parkinson's disease (20)
- Systemic lupus erythematosus (19)
- Autoimmune thyroid disease (18)
- Neuroactive ligand-receptor interaction (18)
- Primary immunodeficiency (17)
- Allograft rejection (14)
- Antigen processing and presentation (14)
- Phosphatidylinositol signaling system (14)
- Retinol metabolism (14)
- Renin-angiotensin system (12)
- Type I diabetes mellitus (12)
- Starch and sucrose metabolism (10)
- ABC transporters (9)
- Cardiac muscle contraction (9)
- Complement and coagulation cascades (9)
- Graft-versus-host disease (9)
- Drug metabolism - cytochrome P450 (8)
- Drug metabolism - other enzymes (8)
- Galactose metabolism (8)
- Linoleic acid metabolism (8)
- Lysosome (8)
- Metabolism of xenobiotics by cytochrome P450 (8)
- Nicotinate and nicotinamide metabolism (7)
- Glutathione metabolism (6)
- Asthma (5)
- Oxidative phosphorylation (4)
- Tyrosine metabolism (4)
- PPAR signaling pathway (3)
- Purine metabolism (3)
- Pyrimidine metabolism (3)
- Regulation of autophagy (3)
- Amino sugar and nucleotide sugar metabolism (2)
- Citrate cycle (TCA cycle) (2)
- Cysteine and methionine metabolism (2)
- Fructose and mannose metabolism (2)
- Inositol phosphate metabolism (2)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Pyruvate metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- Ubiquitin mediated proteolysis (2)
- tyrosine and tryptophan biosynthesis (2)
- Primary bile acid biosynthesis (1)