TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
Applications | FC, FN, IHC, IP, WB |
Reactivities | Human |
USD 440.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
Applications | ELISA, IHC, R |
Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, Azide Free
Applications | FC, FN, IHC, IP |
Reactivities | Human |
Rabbit polyclonal IL1R Antibody (C-term E487)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal CD30 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 515.00
In Stock
Rabbit Monoclonal antibody against CD25
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL3RA |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free
Applications | FC, FN |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free
Applications | FC, FN |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free
Applications | FC, FN, IP, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
Applications | FC, FN |
Reactivities | Human |
Rabbit Polyclonal CD130 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K11, Azide Free
Applications | ELISA, FC, IP |
Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
IL6R rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
CD130 (IL6ST) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 878-906 amino acids from the C-terminal region of human CD130 |
IL12B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B. |
Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930) |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human KIT. |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Azide Free
Applications | FC, FN |
Reactivities | Human |
USD 250.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Purified
Applications | FC, IHC |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Azide Free
Applications | FC, FN |
Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
IL6R mouse monoclonal antibody, clone B-R6, Purified
Applications | FC, IHC |
Reactivities | Human |
CD130 (IL6ST) pTyr905 rabbit polyclonal antibody
Reactivities | Human |
Immunogen | KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y905 of Human IL6ST |
IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
TNFRSF1B (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human TNFR2/TNFRSF1B. |
IL12B mouse monoclonal antibody, clone 1-1A4, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Goat Polyclonal Antibody against IL12B / IL12p40
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2. |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
Modifications | Phospho-specific |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Mouse monoclonal KIT Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal CD130/gp130 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD130/gp130 |
Rabbit Polyclonal c-Kit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal Anti-IL18R1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL18R1 antibody: synthetic peptide directed towards the N terminal of human IL18R1. Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
USD 300.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-G3, Azide Free
Applications | FC |
Reactivities | Human |