Research Areas

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free

Applications FC, FN, IHC, IP, WB
Reactivities Human

IL6R mouse monoclonal antibody, clone B-R6, Azide Free

Applications FC, FN, IHC, IP
Reactivities Human

Rabbit polyclonal IL1R Antibody (C-term E487)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R.

Rabbit Polyclonal CD30 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal Anti-IL3RA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL3RA

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free

Applications FC, FN, IHC
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free

Applications FC, FN
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free

Applications FC, FN
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free

Applications FC, FN, IP, WB
Reactivities Human

c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE

Applications FC
Reactivities Human
Conjugation PE

c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free

Applications FC, FN
Reactivities Human

Rabbit Polyclonal CD130 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

CD130 (IL6ST) mouse monoclonal antibody, clone B-K11, Azide Free

Applications ELISA, FC, IP
Reactivities Human

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit.

IL6R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

CD130 (IL6ST) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 878-906 amino acids from the C-terminal region of human CD130

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.

Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930)

Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703
Modifications Phospho-specific

Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721.
Modifications Phospho-specific

Rabbit Polyclonal KIT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human KIT.

CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Azide Free

Applications FC, FN
Reactivities Human

IL6R mouse monoclonal antibody, clone B-R6, FITC

Applications FC
Reactivities Human
Conjugation FITC

IL6R mouse monoclonal antibody, clone B-R6, Purified

Applications FC, IHC
Reactivities Human

CD130 (IL6ST) pTyr905 rabbit polyclonal antibody

Reactivities Human
Immunogen KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y905 of Human IL6ST

IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

TNFRSF1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human TNFR2/TNFRSF1B.

IL12B mouse monoclonal antibody, clone 1-1A4, Purified

Applications ELISA, IHC
Reactivities Human

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.

Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R).
Modifications Phospho-specific

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit Polyclonal CD130/gp130 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD130/gp130

Rabbit Polyclonal c-Kit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Kit

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

Rabbit Polyclonal Anti-IL18R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18R1 antibody: synthetic peptide directed towards the N terminal of human IL18R1. Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Biotin

Applications FC
Reactivities Human
Conjugation Biotin

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, FITC

Applications FC
Reactivities Human
Conjugation FITC