Research Areas

View as table Download

CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free

Applications FC, FN, IHC, IP, WB
Reactivities Human

IL6R mouse monoclonal antibody, clone B-R6, Azide Free

Applications FC, FN, IHC, IP
Reactivities Human

Rabbit Polyclonal Anti-IL3RA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL3RA

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free

Applications FC, FN, IHC
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free

Applications FC, FN
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free

Applications FC, FN
Reactivities Human

CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free

Applications FC, FN, IP, WB
Reactivities Human

Rabbit Polyclonal CD130 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

CD130 (IL6ST) mouse monoclonal antibody, clone B-K11, Azide Free

Applications ELISA, FC, IP
Reactivities Human

IL6R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

CD130 (IL6ST) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 878-906 amino acids from the C-terminal region of human CD130

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.

CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Azide Free

Applications FC, FN
Reactivities Human

IL6R mouse monoclonal antibody, clone B-R6, FITC

Applications FC
Reactivities Human
Conjugation FITC

IL6R mouse monoclonal antibody, clone B-R6, Purified

Applications FC, IHC
Reactivities Human

CD130 (IL6ST) pTyr905 rabbit polyclonal antibody

Reactivities Human
Immunogen KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y905 of Human IL6ST

IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

IL12B mouse monoclonal antibody, clone 1-1A4, Purified

Applications ELISA, IHC
Reactivities Human

Goat Polyclonal Antibody against IL12B / IL12p40

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2.

Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R).
Modifications Phospho-specific

Rabbit Polyclonal CD130/gp130 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD130/gp130

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Biotin

Applications FC
Reactivities Human
Conjugation Biotin

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Purified

Applications FC
Reactivities Human

Rabbit polyclonal IL3RA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA.

Rabbit Polyclonal CD130 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CD130/gp130.

Rabbit Polyclonal Anti-IL3RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS

Rabbit anti CD25 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant full length (1-272 aa) of human CD25.

Carrier-free (BSA/glycerol-free) IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL6R mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI4A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI1E12

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D1

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D4

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Anti-IL2RA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 260-272 amino acids of Human interleukin 2 receptor, alpha

Anti-IL2RA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 260-272 amino acids of Human interleukin 2 receptor, alpha

IL6ST Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP