CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
Applications | FC, FN, IHC, IP, WB |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
Applications | FC, FN, IHC, IP, WB |
Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, Azide Free
Applications | FC, FN, IHC, IP |
Reactivities | Human |
USD 515.00
In Stock
Rabbit Monoclonal antibody against CD25
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL3RA |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free
Applications | FC, FN |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free
Applications | FC, FN |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free
Applications | FC, FN, IP, WB |
Reactivities | Human |
Rabbit Polyclonal CD130 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K11, Azide Free
Applications | ELISA, FC, IP |
Reactivities | Human |
IL6R rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
CD130 (IL6ST) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 878-906 amino acids from the C-terminal region of human CD130 |
IL12B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B. |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Azide Free
Applications | FC, FN |
Reactivities | Human |
USD 250.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Purified
Applications | FC, IHC |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Azide Free
Applications | FC, FN |
Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
IL6R mouse monoclonal antibody, clone B-R6, Purified
Applications | FC, IHC |
Reactivities | Human |
CD130 (IL6ST) pTyr905 rabbit polyclonal antibody
Reactivities | Human |
Immunogen | KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y905 of Human IL6ST |
IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL12B mouse monoclonal antibody, clone 1-1A4, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Goat Polyclonal Antibody against IL12B / IL12p40
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2. |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
Modifications | Phospho-specific |
Rabbit Polyclonal CD130/gp130 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD130/gp130 |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
USD 300.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-G3, Azide Free
Applications | FC |
Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD130 (IL6ST) mouse monoclonal antibody, clone B-R3, Purified
Applications | FC |
Reactivities | Human |
Rabbit polyclonal IL3RA Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal CD130 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CD130/gp130. |
Rabbit Polyclonal Anti-IL3RA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Rabbit anti CD25 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant full length (1-272 aa) of human CD25. |
Carrier-free (BSA/glycerol-free) IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL6R mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL2RA mouse monoclonal antibody, clone OTI2C7
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL2RA mouse monoclonal antibody, clone OTI1A6
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL2RA mouse monoclonal antibody, clone OTI2A5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI4A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI1E12
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D1
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D4
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-IL2RA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 260-272 amino acids of Human interleukin 2 receptor, alpha |
Anti-IL2RA Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 260-272 amino acids of Human interleukin 2 receptor, alpha |
IL6ST Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
IL6R mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |