L3 (NC_001460) Virus Tagged ORF Clone
CAT#: VC100269
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040925
View other clones from "Virus" (35)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | L3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100269 represents NCBI reference of NP_040925 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAAGCTCAGAGCAGGAACTCACTGCCATAGTGCGGGACCTGGGCTGCGGACCTTATTTTCTTGGTA CATTTGATAAGCGCTTTCCAGGTTTTGTCTCACGCGATAGACTGAGTTGCGCAATAGTCAACACCGCTGG GCGCGAGACTGGCGGGGTGCACTGGCTGGCCTTCGGCTGGAACCCAAAAAGCCACACCTGCTATCTGTTT GACCCCTTTGGCTTTTCTGATCAAAGGTTGAAGCAGATCTACCAGTTTGAGTACGAGTCTCTTCTGAGAA GGTCCGCCCTCGCTGCAACAAAAGACAGATGTGTGACACTCGAAAAGTCTACACAAACAGTCCAAGGCCC CTTCTCTGCCGCATGCGGGCTGTTTTGTTGTATGTTCCTGCACGCTTTCACCCACTGGCCGGACCATCCG ATGGACAAGAACCCGACTATGGATTTGCTTACCGGGGTGCCAAATTGCATGCTCCAGAGCCCACAGGTGG TAGGGACATTGCAACGCAATCAGAACGAGCTGTATAAATTCCTTAACAATCTCTCCCCCTACTTCAGGCA CAATCGCGAGAGGATCGAAAAGGCCACCTCTTTTACCAAAATGCAAAACGGACTCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100269 representing NP_040925
Red=Cloning sites Green=Tags MGSSEQELTAIVRDLGCGPYFLGTFDKRFPGFVSRDRLSCAIVNTAGRETGGVHWLAFGWNPKSHTCYLF DPFGFSDQRLKQIYQFEYESLLRRSALAATKDRCVTLEKSTQTVQGPFSAACGLFCCMFLHAFTHWPDHP MDKNPTMDLLTGVPNCMLQSPQVVGTLQRNQNELYKFLNNLSPYFRHNRERIEKATSFTKMQNGLK TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001460 |
ORF Size | 618 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_001460.1, NP_040925 |
RefSeq ORF | 618 |
Locus ID | 1460858 |
MW | 23.5 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100254 | Myc-DDK-tagged ORF clone of viral ORF for E1A gene product [Human adenovirus A], codon optimized for human cell expression, NP_040910 |
USD 400.00 |
|
VC100255 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040911 |
USD 400.00 |
|
VC100256 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040912 |
USD 620.00 |
|
VC100257 | Myc-DDK-tagged ORF clone of viral ORF for IX gene product [Human adenovirus A], codon optimized for human cell expression, NP_040913 |
USD 400.00 |
|
VC100258 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040914 |
USD 580.00 |
|
VC100259 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040915 |
USD 1,880.00 |
|
VC100260 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040916 |
USD 400.00 |
|
VC100261 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040917 |
USD 810.00 |
|
VC100262 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040918 |
USD 470.00 |
|
VC100263 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040919 |
USD 740.00 |
|
VC100264 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040920 |
USD 640.00 |
|
VC100265 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040921 |
USD 430.00 |
|
VC100266 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040922 |
USD 400.00 |
|
VC100267 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040923 |
USD 400.00 |
|
VC100268 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040924 |
USD 1,460.00 |
|
VC100270 | Myc-DDK-tagged ORF clone of viral ORF for E2A-L gene product [Human adenovirus A], codon optimized for human cell expression, NP_040926 |
USD 620.00 |
|
VC100271 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040927 |
USD 1,250.00 |
|
VC100272 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040928 |
USD 400.00 |
|
VC100273 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040929 |
USD 400.00 |
|
VC100274 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040930 |
USD 400.00 |
|
VC100275 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040932 |
USD 400.00 |
|
VC100276 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040931 |
USD 400.00 |
|
VC100277 | Myc-DDK-tagged ORF clone of viral ORF for L5 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040933 |
USD 740.00 |
|
VC100278 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040934 |
USD 400.00 |
|
VC100279 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040935 |
USD 400.00 |
|
VC100280 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040936 |
USD 400.00 |
|
VC100281 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597783 |
USD 400.00 |
|
VC100282 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597784 |
USD 400.00 |
|
VC100283 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640219 |
USD 400.00 |
|
VC100284 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640220 |
USD 400.00 |
|
VC100285 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640221 |
USD 400.00 |
|
VC100286 | Myc-DDK-tagged ORF clone of viral ORF for U gene product, partial [Human adenovirus A], codon optimized for human cell expression, YP_002640222 |
USD 400.00 |
|
VC100287 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640218 |
USD 400.00 |
|
VC100288 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640223 |
USD 400.00 |
|
VC100289 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640224 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review