E3 (NC_003266) Virus Tagged ORF Clone
CAT#: VC100486
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-beta [Human adenovirus E], codon optimized for human cell expression, YP_068042
View other clones from "Virus" (37)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | E3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100486 represents NCBI reference of YP_068042 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTAGTGTGACTGCTATAATATATTTCCTGGGCCTGCTGGGCTTCATAAACAGTTTCGACCATAAGA ACGTCACAGCTTACGTTGGTAGTAACTGCGTTCTGACTGGATATCAATCTCACCAGCGGGTGAGCTGGTA CTGGTTTGATAAGAAGAACACTGCATATACACTTTGTAAAGGCAATCAGCGGCCCACACAAAGATCCGGG CTGTATTACTCCTGTACTAATAACAACATTACTCTGCTGCAGGTTACCAAACAGTACTCTGGAACCTATT ATGGGACCAACTTTAATACCGAACAAGATACCTACTATAGTGTCAAAGTGCTTGATCCTACGACACCAAG AACCACCACTAAGCATACAACAACGAAGAAACCTACTATCCCTAAAACCACTAAATTGACTACCACCACT TCAACCACACTCGCCGTTACTAGCCAGGCAACGACTGAGAACGAGTTGGTGGCTCTCCTCCAGAACGGCG AAAATAACAGCTCTTCACCATTGCCCACCACACCTTCAGAGCAGATTCCCAGGAGTATGATTGGGATTAT TGCCGCTGTGGTAGTTTGCATGGTAATCATAATTTTGTGTATGATGTACTATGCTTGCTACTATCGGAAA CATAGGCTGAACAACAAACTGGACCCCTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100486 representing YP_068042
Red=Cloning sites Green=Tags MASVTAIIYFLGLLGFINSFDHKNVTAYVGSNCVLTGYQSHQRVSWYWFDKKNTAYTLCKGNQRPTQRSG LYYSCTNNNITLLQVTKQYSGTYYGTNFNTEQDTYYSVKVLDPTTPRTTTKHTTTKKPTIPKTTKLTTTT STTLAVTSQATTENELVALLQNGENNSSSPLPTTPSEQIPRSMIGIIAAVVVCMVIIILCMMYYACYYRK HRLNNKLDPY TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_003266 |
ORF Size | 660 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_003266.2, YP_068042 |
RefSeq ORF | 660 |
Locus ID | 2958477 |
MW | 24.8 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100462 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1A [Human adenovirus E], codon optimized for human cell expression, YP_068018 |
USD 400.00 |
|
VC100463 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 19K [Human adenovirus E], codon optimized for human cell expression, YP_068019 |
USD 400.00 |
|
VC100464 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 55K [Human adenovirus E], codon optimized for human cell expression, YP_068020 |
USD 620.00 |
|
VC100465 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein IX [Human adenovirus E], codon optimized for human cell expression, YP_068021 |
USD 400.00 |
|
VC100466 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein IVa2 [Human adenovirus E], codon optimized for human cell expression, YP_068022 |
USD 580.00 |
|
VC100467 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human adenovirus E], codon optimized for human cell expression, YP_068023 |
USD 1,900.00 |
|
VC100468 | Myc-DDK-tagged ORF clone of viral ORF for terminal protein precursor pTP [Human adenovirus E], codon optimized for human cell expression, YP_068024 |
USD 810.00 |
|
VC100469 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 52K [Human adenovirus E], codon optimized for human cell expression, YP_068025 |
USD 490.00 |
|
VC100470 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pIIIa [Human adenovirus E], codon optimized for human cell expression, YP_068026 |
USD 750.00 |
|
VC100471 | Myc-DDK-tagged ORF clone of viral ORF for penton base [Human adenovirus E], codon optimized for human cell expression, YP_068027 |
USD 680.00 |
|
VC100472 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pVII [Human adenovirus E], codon optimized for human cell expression, YP_068028 |
USD 400.00 |
|
VC100473 | Myc-DDK-tagged ORF clone of viral ORF for core protein V [Human adenovirus E], codon optimized for human cell expression, YP_068029 |
USD 430.00 |
|
VC100474 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pX [Human adenovirus E], codon optimized for human cell expression, YP_068030 |
USD 400.00 |
|
VC100475 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVI [Human adenovirus E], codon optimized for human cell expression, YP_068031 |
USD 400.00 |
|
VC100476 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus E], codon optimized for human cell expression, YP_068032 |
USD 1,480.00 |
|
VC100477 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus E], codon optimized for human cell expression, YP_068033 |
USD 400.00 |
|
VC100478 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human adenovirus E], codon optimized for human cell expression, YP_068034 |
USD 650.00 |
|
VC100479 | Myc-DDK-tagged ORF clone of viral ORF for hexon assembly protein 100K [Human adenovirus E], codon optimized for human cell expression, YP_068035 |
USD 1,270.00 |
|
VC100480 | Myc-DDK-tagged ORF clone of viral ORF for protein 33K [Human adenovirus E], codon optimized for human cell expression, YP_068036 |
USD 400.00 |
|
VC100481 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 22K [Human adenovirus E], codon optimized for human cell expression, YP_068037 |
USD 400.00 |
|
VC100482 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVIII [Human adenovirus E], codon optimized for human cell expression, YP_068038 |
USD 400.00 |
|
VC100483 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 125K [Human adenovirus E], codon optimized for human cell expression, YP_068039 |
USD 400.00 |
|
VC100484 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-alpha [Human adenovirus E], codon optimized for human cell expression, YP_068040 |
USD 400.00 |
|
VC100485 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 gp19K [Human adenovirus E], codon optimized for human cell expression, YP_068041 |
USD 400.00 |
|
VC100487 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-delta [Human adenovirus E], codon optimized for human cell expression, YP_068043 |
USD 400.00 |
|
VC100488 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-alpha [Human adenovirus E], codon optimized for human cell expression, YP_068044 |
USD 400.00 |
|
VC100489 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-beta [Human adenovirus E], codon optimized for human cell expression, YP_068045 |
USD 400.00 |
|
VC100490 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 147K [Human adenovirus E], codon optimized for human cell expression, YP_068046 |
USD 400.00 |
|
VC100491 | Myc-DDK-tagged ORF clone of viral ORF for protein U, partial [Human adenovirus E], codon optimized for human cell expression, YP_068047 |
USD 400.00 |
|
VC100492 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus E], codon optimized for human cell expression, YP_068048 |
USD 550.00 |
|
VC100493 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf6/7 [Human adenovirus E], codon optimized for human cell expression, YP_068049 |
USD 400.00 |
|
VC100494 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4 34K [Human adenovirus E], codon optimized for human cell expression, YP_068050 |
USD 400.00 |
|
VC100495 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf4 [Human adenovirus E], codon optimized for human cell expression, YP_068051 |
USD 400.00 |
|
VC100496 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf3 [Human adenovirus E], codon optimized for human cell expression, YP_068052 |
USD 400.00 |
|
VC100497 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf2 [Human adenovirus E], codon optimized for human cell expression, YP_068053 |
USD 400.00 |
|
VC100498 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf1 [Human adenovirus E], codon optimized for human cell expression, YP_068054 |
USD 400.00 |
|
VC100499 | Myc-DDK-tagged ORF clone of viral ORF for protein 136K [Human adenovirus E], codon optimized for human cell expression, YP_001661328 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review