E (NC_006577) Virus Tagged ORF Clone
CAT#: VC100573
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for small membrane protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173240
View other clones from "HCoV-HKU1" (18)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | E |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100573 represents NCBI reference of YP_173240 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTGACCTGTTCTTCAATGACACAGCCTGGTACATCGGACAAATCCTCGTCCTCGTACTTTTCTGCC TTATTAGCTTGATTTTCGTGGTGGCATTCCTTGCCACTATTAAGCTCTGTATGCAGCTGTGTGGTTTCTG CAACTTTTTCATTATCTCACCTAGCGCCTATGTTTATAAAAGGGGAATGCAGTTGTACAAGAGCTACAGT GAGCAGGTAATCCCTCCTACCAGTGATTACCTCATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100573 representing YP_173240
Red=Cloning sites Green=Tags MVDLFFNDTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYVYKRGMQLYKSYS EQVIPPTSDYLI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_006577 |
ORF Size | 246 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_006577.2, YP_173240 |
RefSeq ORF | 246 |
Locus ID | 3200430 |
MW | 9.5 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100570 | Myc-DDK-tagged ORF clone of viral ORF for hemagglutinin-esterase glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173237 |
USD 480.00 |
|
VC100572 | Myc-DDK-tagged ORF clone of viral ORF for non-structural protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173239 |
USD 400.00 |
|
VC100574 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173241 |
USD 400.00 |
|
VC100575 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid phosphoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173242 |
USD 570.00 |
|
VC100576 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid phosphoprotein 2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_173243 |
USD 400.00 |
|
VC100577 | Myc-DDK-tagged ORF clone of viral ORF for nsp1 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460018 |
USD 400.00 |
|
VC100578 | Myc-DDK-tagged ORF clone of viral ORF for nsp2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459934 |
USD 740.00 |
|
VC100579 | Myc-DDK-tagged ORF clone of viral ORF for nsp6 (hydrophobic domain) [Human coronavirus HKU1], codon optimized for human cell expression, YP_460019 |
USD 400.00 |
|
VC100580 | Myc-DDK-tagged ORF clone of viral ORF for nsp5 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459936 |
USD 400.00 |
|
VC100581 | Myc-DDK-tagged ORF clone of viral ORF for nsp7 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459938 |
USD 400.00 |
|
VC100582 | Myc-DDK-tagged ORF clone of viral ORF for nsp8 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460020 |
USD 400.00 |
|
VC100583 | Myc-DDK-tagged ORF clone of viral ORF for nsp9 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459943 |
USD 400.00 |
|
VC100584 | Myc-DDK-tagged ORF clone of viral ORF for nsp10 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459939 |
USD 400.00 |
|
VC100585 | Myc-DDK-tagged ORF clone of viral ORF for nsp13 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459942 |
USD 760.00 |
|
VC100586 | Myc-DDK-tagged ORF clone of viral ORF for nsp14 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460021 |
USD 670.00 |
|
VC100587 | Myc-DDK-tagged ORF clone of viral ORF for nsp15 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460022 |
USD 470.00 |
|
VC100588 | Myc-DDK-tagged ORF clone of viral ORF for nsp16 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460023 |
USD 400.00 |
|
VC100591 | Myc-DDK-tagged ORF clone of viral ORF for nsp4 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459935 |
USD 640.00 |
{0} Product Review(s)
Be the first one to submit a review