Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Stanniocalcin-1 (STC1)
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
Applications | Assay, CT, FC, FN, IHC, IP |
Reactivities | Mouse, Rat |
Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
Rabbit Monoclonal Antibody against S100B (Clone EP1576Y)
Applications | Assay, IHC, WB |
Reactivities | Mouse, Rat, Goat, Human, ZebraFish, Macaque Monkey |
Rabbit Monoclonal antibody against AGL
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 515.00
In Stock
Rabbit Monoclonal antibody against KLKB1
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against FLAP
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against PMP70
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Monoclonal Antibody against CCND1 (Clone EPR2241IHC)
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Monoclonal antibody against EEF1G
Applications | Assay, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against IL-11R alpha (IL11RA)
Applications | Assay, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against MGEA5
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 432.00
In Stock
Rabbit Monoclonal antibody against Alpha-1-Microglobulin (AMBP)
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against CD205
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Resistin (RETN)
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 445.00
5 Days
Rabbit Monoclonal Antibody against Trimethylated Histone H3 Lysine 27, H3K27me3, Histone H3 (trimethyl K27)
Applications | Assay, WB |
Reactivities | All Species |
Rabbit Monoclonal Antibody against CD5 (Clone EP2952)
Applications | Assay, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against DYM
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against POT1
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against Phosphothreonine
Applications | Assay, IHC, WB |
Reactivities | All Species |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal antibody to PAX8CC (paired box 8)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8 |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Monoclonal antibody against Oncomodulin (OCM2)
Applications | Assay, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal H3K9me3 Antibody
Applications | Assay, Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Immunogen | The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
Rabbit Monoclonal Antibody against Trimethylated Histone H3 Lysine 4, H3K4me3, Histone H3 (trimethyl K4)
Applications | Assay, Dot, WB |
Reactivities | All Species |
Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07) |
Rabbit Polyclonal Anti-KLF2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP |
Rabbit Polyclonal HDAC1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide. |
Mouse Monoclonal H3K4me1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Assay, Dot, ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
RAD54 (RAD54L) (1-17) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding aa 1-17 of Human RAD54 protein. |
swi6 (314-328) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein |
MTOR (2440-2457) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Canine, Human, Mouse, Zebrafish |
Immunogen | Synthetic peptide corresponding to amino acids 2440-2457 of human mTOR |
Rabbit Monoclonal Antibody against Acetylated -Lysine
Applications | Assay, IHC, WB |
Reactivities | All Species |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-JUN Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-TAF1 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
Rabbit Polyclonal Anti-SUZ12 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-MED17 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Rabbit Polyclonal Anti-TAF9 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD |
Rabbit polyclonal Anti-PRKCG Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-Hdac6 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM |
Flunixin (COOH) sheep polyclonal antibody, Ig Fraction
Applications | Assay, ELISA |
Immunogen | Flunixin(COOH)-BTG |