Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-OAT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the middle region of human OAT. Synthetic peptide located within the following region: RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
PAH Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PAH |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NOS3 (11)
- TH (11)
- NFKB1 (10)
- GAPDH (9)
- PLCG1 (9)
- PLCG2 (8)
- AKR1B1 (7)
- GAD1 (7)
- GAD2 (6)
- NOS2 (6)
- ACACA (5)
- AK1 (5)
- AKR1A1 (5)
- ALDH1A2 (5)
- ALDOA (5)
- ALPL (5)
- DNMT3A (5)
- DNMT3B (5)
- ENO1 (5)
- GLUL (5)
- HSD17B10 (5)
- NDUFV2 (5)
- PDHA1 (5)
- PFKL (5)
- PKM (5)
- PTGDS (5)
- TK1 (5)
- ACO1 (4)
- AGXT (4)
- ALDH3A1 (4)
- ALDH9A1 (4)
- ALDOB (4)
- AMD1 (4)
- AOX1 (4)
- CAD (4)
- CKM (4)
- COX5B (4)
- CYP19A1 (4)
- ENO2 (4)
- GCK (4)
- GCLM (4)
- GPT (4)
- HDC (4)
- HK1 (4)
- NDUFS1 (4)
- NME2 (4)
- PAFAH1B1 (4)
- PCK1 (4)
- PIK3C3 (4)
- PRDX6 (4)
- PTGS1 (4)
- TPH2 (4)
- AASDHPPT (3)
- ACAD8 (3)
- ACMSD (3)
- ACOX3 (3)
- ACY1 (3)
- ADA (3)
- ADH1B (3)
- ADH4 (3)
- AK4 (3)
- ALDH1A1 (3)
- ALDH4A1 (3)
- ALDH5A1 (3)
- ANPEP (3)
- ASNS (3)
- ATP5F1D (3)
- ATP5PF (3)
- BCL2A1 (3)
- COX4I1 (3)
- CYP2E1 (3)
- CYP3A4 (3)
- DCT (3)
- DGAT1 (3)
- DHFR (3)
- DNMT1 (3)
- FAH (3)
- GALK1 (3)
- GGT1 (3)
- GK (3)
- GNE (3)
- HK2 (3)
- HPSE (3)
- HSD17B4 (3)
- IDH1 (3)
- IDH2 (3)
- ITPK1 (3)
- ME1 (3)
- NAT1 (3)
- NDUFA3 (3)
- NDUFA8 (3)
- NDUFA9 (3)
- NDUFB9 (3)
- NOS1 (3)
- NT5E (3)
- OAT (3)
- ODC1 (3)
- OGT (3)
- PC (3)
- PGK1 (3)