Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- IHC
Isotypes
- IgG
Families
- Druggable Genome
Citations
- Yes
Filter by
Target Symbol
- ABCC4 (2)
- AOX1 (2)
- BAG3 (2)
- BAX (2)
- COL1A1 (2)
- CTSD (2)
- GAD1 (2)
- PTEN (2)
- RAB27A (2)
- RELA (2)
- SERPINA3 (2)
- ABCC5 (1)
- ABCG2 (1)
- ADAM10 (1)
- ADAMDEC1 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- ADH5 (1)
- AGL (1)
- AKAP12 (1)
- ALPG (1)
- ANPEP (1)
- ANTXR1 (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- BID (1)
- CAMK1D (1)
- CAV1 (1)
- CCND2 (1)
- CCNE1 (1)
- CD274 (1)
- CD276 (1)
- CDH5 (1)
- CDK6 (1)
- CDKN2B (1)
- CEBPA (1)
- CENPE (1)
- CP (1)
- CTNNB1 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DAPK1 (1)
- DCN (1)
- DDR1 (1)
- EGFR (1)
- FGF2 (1)
- FOXO1 (1)
- FTH1 (1)
- GAB2 (1)
- GABRA5 (1)
- GAD2 (1)
- GAS6 (1)
- GBA (1)
- GCH1 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- GZMB (1)
- HAVCR1 (1)
- HMMR (1)
- HMOX1 (1)
- HSP90AA1 (1)
- HTT (1)
- IFNB1 (1)
- IGF1R (1)
- IL18 (1)
- IRF3 (1)
- IRS1 (1)
- ISG15 (1)
- ITGA6 (1)
- ITGAX (1)
- ITGB6 (1)
- JAK1 (1)
- JMJD6 (1)
- KCNAB2 (1)
- KDR (1)
- KLK5 (1)
- KLK7 (1)
- LAMA1 (1)
- LAMB3 (1)
- LIF (1)
- LTBR (1)
- MAD2L1 (1)
- MDH2 (1)
- MITF (1)
- MSH6 (1)
- MTNR1A (1)
- MTOR (1)
- MYCN (1)
- NFKB1 (1)
- NGF (1)
- NLRP3 (1)
- NOTCH1 (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (32)
- Focal adhesion (20)
- Metabolic pathways (20)
- Small cell lung cancer (13)
- Prostate cancer (12)
- ECM-receptor interaction (11)
- Chemokine signaling pathway (10)
- Toll-like receptor signaling pathway (10)
- MAPK signaling pathway (9)
- Pancreatic cancer (9)
- Regulation of actin cytoskeleton (9)
- p53 signaling pathway (9)
- Adipocytokine signaling pathway (8)
- Cytokine-cytokine receptor interaction (8)
- Neurotrophin signaling pathway (8)
- RIG-I-like receptor signaling pathway (8)
- Apoptosis (7)
- Colorectal cancer (7)
- Epithelial cell signaling in Helicobacter pylori infection (7)
- Huntington's disease (7)
- Melanoma (7)
- NOD-like receptor signaling pathway (7)
- Acute myeloid leukemia (6)
- Adherens junction (6)
- Cell adhesion molecules (CAMs) (6)
- Cytosolic DNA-sensing pathway (6)
- Glioma (6)
- Jak-STAT signaling pathway (6)
- Leukocyte transendothelial migration (6)
- Cell cycle (5)
- Chronic myeloid leukemia (5)
- Insulin signaling pathway (5)
- Natural killer cell mediated cytotoxicity (5)
- Neuroactive ligand-receptor interaction (5)
- T cell receptor signaling pathway (5)
- Tight junction (5)
- ABC transporters (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- B cell receptor signaling pathway (4)
- Drug metabolism - cytochrome P450 (4)
- Endocytosis (4)
- Endometrial cancer (4)
- ErbB signaling pathway (4)
- Gap junction (4)
- Lysosome (4)
- Oocyte meiosis (4)
- Progesterone-mediated oocyte maturation (4)
- Renal cell carcinoma (4)
- Type I diabetes mellitus (4)
- Alanine (3)
- Alzheimer's disease (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Axon guidance (3)
- Butanoate metabolism (3)
- Calcium signaling pathway (3)
- Dilated cardiomyopathy (3)
- GnRH signaling pathway (3)
- Hematopoietic cell lineage (3)
- Melanogenesis (3)
- Porphyrin and chlorophyll metabolism (3)
- Prion diseases (3)
- TGF-beta signaling pathway (3)
- Taurine and hypotaurine metabolism (3)
- Type II diabetes mellitus (3)
- Tyrosine metabolism (3)
- Valine (3)
- Viral myocarditis (3)
- Wnt signaling pathway (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Bladder cancer (2)
- Citrate cycle (TCA cycle) (2)
- Complement and coagulation cascades (2)
- Dorso-ventral axis formation (2)
- Fc epsilon RI signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Folate biosynthesis (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Inositol phosphate metabolism (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Non-small cell lung cancer (2)
- PPAR signaling pathway (2)
- Pathogenic Escherichia coli infection (2)
- Phosphatidylinositol signaling system (2)
- Primary bile acid biosynthesis (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Retinol metabolism (2)
- SNARE interactions in vesicular transport (2)
- Sphingolipid metabolism (2)
- Tryptophan metabolism (2)
- VEGF signaling pathway (2)
- Vascular smooth muscle contraction (2)
- Vitamin B6 metabolism (2)
- Allograft rejection (1)
- Androgen and estrogen metabolism (1)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Basal cell carcinoma (1)
- Base excision repair (1)
- DNA replication (1)
- Drug metabolism - other enzymes (1)
- Fatty acid metabolism (1)
- Fructose and mannose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Graft-versus-host disease (1)
- Homologous recombination (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Methane metabolism (1)
- Notch signaling pathway (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Renin-angiotensin system (1)
- Starch and sucrose metabolism (1)
- Thyroid cancer (1)
- Vibrio cholerae infection (1)
- mTOR signaling pathway (1)