Antibodies

View as table Download

Rabbit Polyclonal Anti-TRPP1 (PKD2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus.

Rabbit Polyclonal TRPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6.

Rabbit Polyclonal Anti-TRPA1 (extracellular)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NSTGIINETSDHSE, corresponding to amino acid residues 747-760 of human TRPA1. 1st extracellular loop.

Rabbit Polyclonal Anti-Alpha-tubulin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Alpha-tubulin antibody was raised against an 18 amino acid peptide near the amino terminus of human alpha-tubulin

Rabbit Polyclonal Anti-TRPM7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKRRKKDKTSDGPKLFLTEE, corresponding to amino acid residues 1146-1165 of human TRPM7. Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

Rabbit Polyclonal Antibody against TRPM8 (Center R536)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7]

Rabbit Polyclonal TRPC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6.

Mouse Monoclonal anti-trpm7 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRPV2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%).

Mouse Monoclonal anti-TRPC5 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal TRPA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus (residues 1-100) of the human TRPA1 protein. [Swiss-Prot# O75762]

Rabbit Polyclonal Anti-TRPA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL

Rabbit Polyclonal TRPC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3.

TRPC5 Mouse Monoclonal (S67-15) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal anti-TRPC6 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated

Anti-TRPC3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3

Rabbit Polyclonal Anti-TRPM8 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SDVDGTTYDFAHC, corresponding to amino acid residues 917-929 of human TRPM8. 3rd extracellular loop.

Rabbit Polyclonal TRPC3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC3.

Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759)

Rabbit Polyclonal TRPV4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4.

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Rabbit Polyclonal Antibody against TRPM8 (C-term C940)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 926-956 amino acids from the C-terminal region of human TRPM8.

Mouse Monoclonal anti-trpc4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal TRPM8 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8.

Rabbit polyclonal TRPC5 Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5.

Rabbit Polyclonal Anti-TRPV6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NRGLEDGESWEYQI, corresponding to amino acid residues 712-725 of human TRPV6.Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPV3 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)REEEAIPHPLALTHK, corresponding to amino acid residues 464-478 of human TRPV3. 1st extracellular loop.

Rabbit Polyclonal Anti-TRPV5

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GLNLSEGDGEEVYHF, corresponding to amino acid residues 715-729 of human TRPV5. Intracellular, C-terminus.

Rabbit polyclonal Anti-TRPV5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Rabbit Polyclonal Anti-TRPM8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Rabbit Polyclonal Antibody against TRPM8 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1075-1104 amino acids from the C-terminal region of human TRPM8.

Rabbit Polyclonal Anti-TRPC5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HKWGDGQEEQVTTRL, corresponding to amino acid residues 959-973 of human TRPC5. Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPM4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide EKEQSWIPKIFKK(C), corresponding to amino acid residues 5-17 of human TRPM4. Intracellular, N-terminus.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides made to residues 278-292 RNQLEKYISERTIQD and the C-terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein.

Rabbit Polyclonal Anti-TRPV4 Antibody

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Rabbit Polyclonal Anti-TRPC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS

Rabbit Polyclonal TRPV1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an C-terminal region of the human TRPV1 protein (within residues 725-839). [Swiss-Prot Q8NER1]

TRPV4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%).

Rabbit Polyclonal Anti-TRPA1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TRPA1 antibody was raised against synthetic 18 amino acid peptide from internal region of human TRPA1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset (94%); Dog, Bovine, Elephant (89%); Rat, Bat, Panda, Horse, Rabbit (83%).

Rabbit Polyclonal Anti-TRPM8 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TRPM8 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPM8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bat, Dog, Rabbit, Horse, Guinea pig, Turkey, Chicken, Armadillo, Platypus (100%); Galago, Marmoset, Bovine, Pig, Opossum, Xenopus (93%); Lizard (87%).

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Anti-TRPC3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 823-836 amino acids of human transient receptor potential cation channel, subfamily C, member 3

Anti-TRPM7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7

Anti-TRPM7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7

Anti-TRPM5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5

Anti-TRPA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1105-1119 amino acids of human transient receptor potential cation channel, subfamily A, member 1