Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
Download
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal Anti-UMPS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS. Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal Anti-LDHB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD |
Rabbit Polyclonal Anti-SQLE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Druggable Genome
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (137)
- OTC (117)
- LIPG (115)
- PIK3C2A (72)
- ABAT (54)
- TYMP (54)
- MGLL (52)
- LTA4H (51)
- PFKP (51)
- AKR1A1 (50)
- TYMS (48)
- AMACR (47)
- GCH1 (47)
- ACAT2 (46)
- NME4 (45)
- CYP1A2 (42)
- ATP5F1B (41)
- CMPK1 (36)
- IDO1 (35)
- RRM1 (35)
- GBA (31)
- GBE1 (30)
- GPI (30)
- PNMT (30)
- ADH1B (29)
- TBXAS1 (28)
- UPRT (28)
- AK4 (27)
- CYP2A6 (26)
- DLD (26)
- GRHPR (26)
- LDHA (25)
- TH (25)
- GAD1 (23)
- AK5 (22)
- ALOX15 (22)
- ALOX5 (22)
- ANPEP (22)
- CAT (21)
- CYP2E1 (21)
- KHK (21)
- ALDH1A3 (20)
- ASS1 (20)
- DHRS4L2 (20)
- HSD17B10 (20)
- OXSM (20)
- PAPSS2 (20)
- SDHB (20)
- PON1 (19)
- ACADM (17)
- CYP2J2 (17)
- DCXR (17)
- GLB1 (17)
- ADH5 (16)
- BDH2 (16)
- CYP2C9 (16)
- FH (16)
- PGAM2 (16)
- TALDO1 (16)
- ALDH3A1 (15)
- CPS1 (15)
- IDS (15)
- ALDOB (13)
- CD38 (13)
- HSD17B4 (13)
- PNLIP (13)
- ALOX12 (12)
- ALPI (12)
- ARG1 (12)
- ATP6V1B1 (12)
- PIKFYVE (12)
- RRM2 (12)
- SPR (12)
- ADH7 (11)
- DHFR (11)
- GATM (11)
- GUK1 (11)
- HSD17B8 (11)
- MAOA (11)
- PHGDH (11)
- PPAT (11)
- PRODH (11)
- ALDH4A1 (10)
- ALDH7A1 (10)
- DGKA (10)
- ENO1 (10)
- FDFT1 (10)
- GSS (10)
- PAFAH1B3 (10)
- PANK2 (10)
- PDXK (10)
- PIK3C2B (10)
- PPT1 (10)
- ALDH3A2 (9)
- GCK (9)
- NFKB1 (9)
- PLPP1 (9)
- PRDX6 (9)
- SPHK1 (9)
- ACADS (8)
Reactivities
- Human (2965)
- Mouse (2025)
- Rat (1908)
- Monkey (245)
- Dog (242)
- Bovine (37)
- Pig (32)
- Xenopus (12)
- Chicken (11)
- Rabbit (11)
- Chimpanzee (8)
- Cow (8)
- Gibbon (8)
- Gorilla (8)
- Horse (7)
- X. tropicalis (7)
- Rhesus Monkey (6)
- Zebrafish (6)
- Orang-Utan (5)
- Hamster (3)
- Bat (2)
- Drosophila (2)
- Feline (2)
- Porcine (2)
- Primate (2)
- C. elegans (1)
- Canine (1)
- Guinea Pig (1)