Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
TTR / Transthyretin Mouse Monoclonal (10E1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PTHLH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Rabbit Polyclonal Anti-ASPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Chicken Polyclonal Albumin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Albumin antibody was raised against a 13 amino acid synthetic peptide near the center of human Albumin. The immunogen is located within amino acids 340 - 390 of Albumin. |
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
Active filters
Applications
- IHC
Families
- Secreted Protein
Filter by
Target Symbol
- MSMB (121)
- LIPG (115)
- KLK8 (113)
- ADIPOQ (81)
- CHGA (80)
- LGALS3 (75)
- EGFR (59)
- AGR2 (54)
- LOX (53)
- F13A1 (51)
- CD163 (50)
- SYP (48)
- VWF (47)
- AFP (42)
- MUC1 (42)
- CFI (41)
- CD40 (40)
- APOE (39)
- CRP (38)
- KLK3 (38)
- CD8A (35)
- ACE2 (34)
- VIP (34)
- FCER2 (33)
- FGG (33)
- SERPINA1 (33)
- SERPINB3 (33)
- GNAS (32)
- PMEL (31)
- GRN (30)
- SERPINB2 (27)
- SIL1 (27)
- SYT4 (27)
- TFF1 (27)
- ERBB3 (26)
- CSF2 (24)
- TIMP2 (24)
- TFPI (23)
- CCN2 (22)
- FGFR2 (22)
- LAMB3 (22)
- MSLN (22)
- WFDC2 (22)
- WNT3 (22)
- CPA2 (21)
- LGALS3BP (21)
- MGP (21)
- PON3 (21)
- RNASE11 (20)
- FGF21 (19)
- FN1 (19)
- PON1 (19)
- TFPI2 (19)
- TNF (19)
- B2M (18)
- NPPB (18)
- SPP1 (18)
- CSF1 (17)
- CSF3 (17)
- NTF3 (17)
- IGF1 (16)
- IL1A (16)
- ADAMTS1 (15)
- CPA1 (15)
- FOLR2 (15)
- IL24 (15)
- NOG (15)
- RNPEP (15)
- APOH (14)
- GCG (14)
- LOXL2 (14)
- PTH (14)
- SHBG (14)
- IL1RN (13)
- IL2 (13)
- IL20 (13)
- PNLIP (13)
- PRL (13)
- SERPINB4 (13)
- TFF3 (13)
- ACE (12)
- AMY2A (12)
- IL36G (12)
- POSTN (12)
- REN (12)
- RSPO1 (12)
- SERPINE2 (12)
- TAC1 (12)
- VEGFB (12)
- C2 (11)
- CLU (11)
- IL6 (11)
- LTF (11)
- PROZ (11)
- RSPO3 (11)
- SPINT1 (11)
- ADM (10)
- AZGP1 (10)
- CCL19 (10)
- DPP4 (10)
Reactivities
- Human (3845)
- Mouse (1397)
- Rat (1174)
- Dog (124)
- Monkey (116)
- Bovine (47)
- Pig (32)
- Rabbit (30)
- Horse (21)
- Gorilla (20)
- Gibbon (19)
- Bat (18)
- Hamster (15)
- Chicken (11)
- Mammalian (11)
- Primate (11)
- Cow (7)
- Porcine (6)
- Xenopus (6)
- Canine (5)
- Chimpanzee (4)
- Guinea Pig (4)
- Orang-Utan (4)
- Equine (3)
- Rhesus Monkey (3)
- Sheep (3)
- Zebrafish (3)
- Feline (2)
- Opossum (2)
- Amphibian (1)
- Birds (1)
- Goat (1)
- Macaque (1)
- Pufferfish (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Cytokine-cytokine receptor interaction (621)
- Pathways in cancer (443)
- Complement and coagulation cascades (339)
- Focal adhesion (257)
- MAPK signaling pathway (246)
- Jak-STAT signaling pathway (232)
- Hematopoietic cell lineage (219)
- Metabolic pathways (212)
- Regulation of actin cytoskeleton (174)
- Prostate cancer (147)
- ECM-receptor interaction (139)
- Toll-like receptor signaling pathway (137)
- Adipocytokine signaling pathway (133)
- Melanoma (131)
- Glycerolipid metabolism (130)
- Melanogenesis (127)
- Endocytosis (122)
- Calcium signaling pathway (117)
- Allograft rejection (116)
- Pancreatic cancer (113)
- PPAR signaling pathway (112)
- Wnt signaling pathway (111)
- T cell receptor signaling pathway (110)
- Bladder cancer (109)
- Hedgehog signaling pathway (109)
- Type II diabetes mellitus (109)
- GnRH signaling pathway (105)
- Basal cell carcinoma (101)
- Type I diabetes mellitus (97)
- Systemic lupus erythematosus (96)
- ErbB signaling pathway (95)
- Gap junction (91)
- TGF-beta signaling pathway (91)
- Autoimmune thyroid disease (83)
- Asthma (81)
- Chemokine signaling pathway (80)
- Dilated cardiomyopathy (79)
- Primary immunodeficiency (79)
- Cell adhesion molecules (CAMs) (78)
- Glioma (78)
- Graft-versus-host disease (78)
- Alzheimer's disease (77)
- Colorectal cancer (71)
- Hypertrophic cardiomyopathy (HCM) (70)
- Natural killer cell mediated cytotoxicity (68)
- Renin-angiotensin system (68)
- Antigen processing and presentation (67)
- Apoptosis (67)
- Epithelial cell signaling in Helicobacter pylori infection (66)
- mTOR signaling pathway (64)
- Non-small cell lung cancer (62)
- Neuroactive ligand-receptor interaction (61)
- Small cell lung cancer (61)
- Adherens junction (59)
- Dorso-ventral axis formation (59)
- Endometrial cancer (59)
- Fc epsilon RI signaling pathway (57)
- NOD-like receptor signaling pathway (56)
- Long-term depression (54)
- Renal cell carcinoma (54)
- RIG-I-like receptor signaling pathway (49)
- Prion diseases (47)
- Neurotrophin signaling pathway (44)
- Viral myocarditis (42)
- p53 signaling pathway (39)
- Cytosolic DNA-sensing pathway (36)
- Vascular smooth muscle contraction (35)
- Taste transduction (32)
- Vibrio cholerae infection (32)
- Amyotrophic lateral sclerosis (ALS) (29)
- Oocyte meiosis (25)
- Progesterone-mediated oocyte maturation (25)
- Axon guidance (22)
- Starch and sucrose metabolism (18)
- Cell cycle (17)
- Regulation of autophagy (17)
- Fc gamma R-mediated phagocytosis (14)
- Chronic myeloid leukemia (12)
- VEGF signaling pathway (12)
- Maturity onset diabetes of the young (11)
- Histidine metabolism (9)
- Huntington's disease (9)
- Insulin signaling pathway (9)
- Leukocyte transendothelial migration (9)
- SNARE interactions in vesicular transport (8)
- beta-Alanine metabolism (7)
- Arachidonic acid metabolism (6)
- Purine metabolism (6)
- Pyrimidine metabolism (6)
- Amino sugar and nucleotide sugar metabolism (5)
- Ether lipid metabolism (5)
- Pathogenic Escherichia coli infection (5)
- Proteasome (4)
- Acute myeloid leukemia (3)
- Glutathione metabolism (3)
- Glycerophospholipid metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Linoleic acid metabolism (3)
- O-Glycan biosynthesis (3)
- Tyrosine metabolism (3)
- alpha-Linolenic acid metabolism (3)
- Arginine and proline metabolism (2)
- Folate biosynthesis (2)
- Glycosaminoglycan degradation (2)
- N-Glycan biosynthesis (2)
- Nitrogen metabolism (2)
- Riboflavin metabolism (2)
- Tryptophan metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Keratan sulfate biosynthesis (1)
- Lysosome (1)
- Other glycan degradation (1)