Antibodies

Jump to Filters

Download

1 - 50 of 1249 results

Page 1 of 25

(reset)

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

TA346659

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PRMT5 Rabbit Polyclonal Antibody

TA327063

USD 275.00

3 Weeks

PRMT5 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human PRMT5

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LAP2 (TMPO) Rabbit Polyclonal Antibody

TA332546

USD 374.00

3 Weeks

Rabbit anti-TMPO Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TMPO

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

HDAC1 Rabbit Polyclonal Antibody

TA326790

USD 374.00

3 Weeks

HDAC1 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	N term -peptide of human HDAC1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MSH6 Rabbit Polyclonal Antibody

TA326879

USD 275.00

In Stock

MSH6 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MSH6

1 / 3

2 / 3

3 / 3

Previous Next

Annexin A3 (ANXA3) Rabbit Polyclonal Antibody

TA349235

USD 380.00

In Stock

Rabbit Polyclonal Anti-ANXA3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human ANXA3

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MCM5 Rabbit Polyclonal Antibody

TA349392

USD 380.00

In Stock

Rabbit Polyclonal Anti-MCM5 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human MCM5

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MCM6 Rabbit Polyclonal Antibody

TA349393

USD 380.00

In Stock

Rabbit Polyclonal Anti-MCM6 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human MCM6

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Prohibitin (PHB) Rabbit Polyclonal Antibody

TA349430

USD 380.00

In Stock

Rabbit Polyclonal Anti-PHB Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PHB

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TA349430 is a possible alternative to TA322982.

Grp75 (HSPA9) Rabbit Polyclonal Antibody

TA326841

USD 275.00

3 Weeks

Rabbit anti-HSPA9 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HSPA9

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HSP90AB1 Rabbit Polyclonal Antibody

TA326919

USD 275.00

3 Weeks

Rabbit anti-HSP90AB1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HSP90AB1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Prion protein PrP (PRNP) Rabbit Monoclonal Antibody [Clone ID: EP1802Y]

TA300958

USD 524.00

In Stock

Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

FUS Rabbit Polyclonal Antibody

TA345726

USD 475.00

5 Days

Rabbit Polyclonal Anti-FUS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOCS1 Rabbit Polyclonal Antibody

TA346364

USD 410.00

5 Days

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GRB7 Rabbit Polyclonal Antibody

TA349333

USD 380.00

In Stock

Rabbit Polyclonal Anti-GRB7 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GRB7

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Oct4 (POU5F1) Rabbit Polyclonal Antibody

TA324014

USD 345.00

In Stock

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

1 / 2

2 / 2

Previous Next

IKB beta (NFKBIB) Rabbit Polyclonal Antibody

TA332909

USD 275.00

3 Weeks

Rabbit anti-NFKBIB Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human NFKBIB

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PHAP1 (ANP32A) Rabbit Polyclonal Antibody

TA345682

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANP32A Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MSH6 Rabbit Polyclonal Antibody

TA346016

USD 475.00

5 Days

Rabbit Polyclonal Anti-MSH6 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody

TA311853

USD 345.00

In Stock

Rabbit polyclonal anti-Cyclin E1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Cyclin E1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RPA34 (RPA2) Rabbit Polyclonal Antibody

TA327326

USD 275.00

3 Weeks

Rabbit anti-RPA2 Polyclonal Antibody

Applications	ChIP, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RPA2

1 / 3

2 / 3

3 / 3

Previous Next

SNRPN Rabbit Polyclonal Antibody

TA349150

USD 484.00

5 Days

Rabbit Polyclonal Anti-SOX4 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	SOX4 antibody was raised against a 16 amino acid peptide near the amino terminus of human SOX4.

1 / 3

2 / 3

3 / 3

Previous Next

MCM2 Rabbit Polyclonal Antibody

TA349394

USD 380.00

In Stock

Rabbit Polyclonal Anti-MCM2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human MCM2

1 / 3

2 / 3

3 / 3

Previous Next

CD168 (HMMR) Rabbit Polyclonal Antibody

TA319659

USD 430.00

2 Weeks

Rabbit Polyclonal RHAMM Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	RHAMM antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human RHAMM.

1 / 3

2 / 3

3 / 3

Previous Next

STIP1 Rabbit Polyclonal Antibody

TA327005

USD 275.00

3 Weeks

STIP1 Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated
Immunogen	Recombinant protein of human STIP1

1 / 3

2 / 3

3 / 3

Previous Next

PARP1 Rabbit Polyclonal Antibody

TA332370

USD 424.00

3 Weeks

Rabbit anti-PARP1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human PARP1

Prion protein PrP (PRNP) Rabbit Polyclonal Antibody

TA332568

USD 275.00

3 Weeks

Rabbit anti-PRNP Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PRNP

1 / 3

2 / 3

3 / 3

Previous Next

Geminin (GMNN) Rabbit Polyclonal Antibody

TA332606

USD 275.00

3 Weeks

Rabbit anti-GMNN Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GMNN

1 / 3

2 / 3

3 / 3

Previous Next

TIP49A (RUVBL1) Rabbit Polyclonal Antibody

TA332864

USD 275.00

3 Weeks

Rabbit anti-RUVBL1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RUVBL1

1 / 2

2 / 2

Previous Next

HMG1 (HMGB1) Rabbit Polyclonal Antibody

TA349024

USD 484.00

5 Days

Rabbit Polyclonal Anti-HMGB1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1.

1 / 3

2 / 3

3 / 3

Previous Next

HDAC2 Rabbit Polyclonal Antibody

TA349073

USD 484.00

5 Days

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	HDAC2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human HDAC2.

1 / 3

2 / 3

3 / 3

Previous Next

alpha Tubulin (TUBA3C) Rabbit Polyclonal Antibody

TA349093

USD 484.00

5 Days

Rabbit Polyclonal Anti-UVRAG Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG.

1 / 3

2 / 3

3 / 3

Previous Next

CDK1 Rabbit Polyclonal Antibody

TA326778

USD 275.00

3 Weeks

Rabbit anti-CDK1 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Center-peptide of human CDK1

1 / 2

2 / 2

Previous Next

BIRC5 Rabbit Polyclonal Antibody

TA332407

USD 275.00

3 Weeks

Rabbit anti-BIRC5 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant Protein of human BIRC5

1 / 3

2 / 3

3 / 3

Previous Next

GADD45A Rabbit Polyclonal Antibody

TA332434

USD 275.00

3 Weeks

Rabbit anti-GADD45A Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human GADD45A

1 / 2

2 / 2

Previous Next

MRE11 Rabbit Polyclonal Antibody

TA332553

USD 275.00

3 Weeks

Rabbit anti-MRE11A Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MRE11A

1 / 3

2 / 3

3 / 3

Previous Next

EBP1 (PA2G4) Rabbit Polyclonal Antibody

TA332652

USD 275.00

3 Weeks

Rabbit anti-PA2G4 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PA2G4

1 / 3

2 / 3

3 / 3

Previous Next

Paxillin (PXN) Rabbit Polyclonal Antibody

TA333025

USD 352.00

3 Weeks

Phospho-PXN-Y118 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding Y118 of human PXN
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

Ku80 (XRCC5) Rabbit Polyclonal Antibody

TA332970

USD 275.00

3 Weeks

Rabbit anti-XRCC5 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human XRCC5

1 / 2

2 / 2

Previous Next

Nucleolin (NCL) Rabbit Polyclonal Antibody

TA309760

USD 457.00

5 Days

Rabbit Polyclonal Nucleolin Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A fusion protein containing amino acids 284-709 of human nucleolin.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hsp60 (HSPD1) Rabbit Polyclonal Antibody

TA326868

USD 275.00

3 Weeks

Rabbit anti-HSPD1 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HSPD1

1 / 2

2 / 2

Previous Next

PSMA3 Rabbit Polyclonal Antibody

TA327024

USD 275.00

3 Weeks

PSMA3 Rabbit Polyclonal Antibody

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PSMA3

1 / 2

2 / 2

Previous Next

POLD1 Rabbit Polyclonal Antibody

TA332610

USD 275.00

3 Weeks

Rabbit anti-POLD1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human POLD1

1 / 2

2 / 2

Previous Next

Thymidine Kinase 1 (TK1) Rabbit Polyclonal Antibody

TA332787

USD 275.00

3 Weeks

Rabbit anti-TK1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TK1

1 / 2

2 / 2

Previous Next

CDK1 Rabbit Polyclonal Antibody

TA333178

USD 352.00

3 Weeks

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

SIRT1 Mouse Monoclonal Antibody [Clone ID: 1F3]

TA336801

USD 457.00

5 Days

Mouse Monoclonal Sirtuin 1/SIRT1 Antibody (1F3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Primate
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: LK2]

TA326374

USD 385.00

5 Days

Mouse monoclonal Hsp60 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

TA327031

USD 380.00

3 Weeks

CCND1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human CCND1

1 / 2

2 / 2

Previous Next

STIP1 Rabbit Polyclonal Antibody

TA308465

USD 415.00

In Stock

Rabbit Polyclonal antibody to STIP1 (stress-induced-phosphoprotein 1)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 300 of STIP1 (Uniprot ID#P31948)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RPA70 (RPA1) Rabbit Polyclonal Antibody

TA308716

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 50 of 1249 results

Page 1 of 25