Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 428.00
In Stock
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
USD 428.00
In Stock
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
USD 380.00
4 Weeks
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit Polyclonal Anti-ZNF71 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF71 antibody: synthetic peptide directed towards the middle region of human ZNF71. Synthetic peptide located within the following region: RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH |
Rabbit Polyclonal Anti-SFPQ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ. Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Isotypes
- IgG
Families
- Transcription Factors
Filter by
Target Symbol
- ESR1 (14)
- STAT1 (14)
- HDAC2 (13)
- RELA (13)
- TP53 (13)
- NR3C1 (11)
- ATF2 (10)
- JUN (10)
- CREB1 (9)
- STAT3 (9)
- BRCA1 (8)
- SMAD3 (8)
- STAT5B (8)
- ENO1 (7)
- FOXO1 (7)
- FOXO4 (7)
- JUND (7)
- STAT6 (7)
- XRCC6 (7)
- ZEB2 (7)
- APEX1 (6)
- AR (6)
- CCNE1 (6)
- CTNNB1 (6)
- EIF2AK2 (6)
- FOS (6)
- GATA3 (6)
- HDAC1 (6)
- HDAC5 (6)
- HDAC6 (6)
- HIF1A (6)
- KDM1A (6)
- KEAP1 (6)
- MYB (6)
- PAX8 (6)
- PRKCQ (6)
- SOX2 (6)
- TNF (6)
- AHR (5)
- BCL6 (5)
- CDK7 (5)
- E2F6 (5)
- ELK1 (5)
- FOXO3 (5)
- HNRNPD (5)
- IKBKG (5)
- KAT5 (5)
- NFKB1 (5)
- NR4A1 (5)
- OLIG2 (5)
- PARP1 (5)
- PIAS2 (5)
- PRDX3 (5)
- SMAD1 (5)
- TFAM (5)
- TP73 (5)
- ATF4 (4)
- CALR (4)
- DLX5 (4)
- EIF4G2 (4)
- ESR2 (4)
- FOXA2 (4)
- FOXP2 (4)
- GABPB1 (4)
- GTF2I (4)
- HDAC4 (4)
- HMGB1 (4)
- HNF1A (4)
- IKBKB (4)
- IRAK1 (4)
- IRF3 (4)
- IRF7 (4)
- JUNB (4)
- KLF4 (4)
- LIN28A (4)
- MCM3 (4)
- MCM6 (4)
- MCM7 (4)
- MED4 (4)
- MEF2A (4)
- MEF2C (4)
- MSX1 (4)
- NFE2L2 (4)
- NFKB2 (4)
- NFKBIB (4)
- NFKBIE (4)
- NRG1 (4)
- PAWR (4)
- PAX3 (4)
- POU5F1 (4)
- PPARD (4)
- PPARG (4)
- RAB25 (4)
- RAD51 (4)
- RB1 (4)
- RBPJ (4)
- SMAD4 (4)
- SMARCA4 (4)
- SOX4 (4)
- SREBF2 (4)
Reactivities
- Human (1686)
- Mouse (1037)
- Rat (734)
- Bovine (52)
- Pig (37)
- Dog (29)
- Cow (19)
- Monkey (18)
- Chicken (14)
- Xenopus (11)
- Rhesus Monkey (10)
- Zebrafish (8)
- Chimpanzee (7)
- Hamster (7)
- Rabbit (7)
- X. tropicalis (6)
- Primate (5)
- Gibbon (4)
- Gorilla (4)
- Horse (4)
- Bat (2)
- Sheep (2)
- Canine (1)
- Canis (1)
- Ferret (1)
- Guinea Pig (1)
- Macaque (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (252)
- MAPK signaling pathway (132)
- Cell cycle (117)
- Chronic myeloid leukemia (106)
- Prostate cancer (101)
- Pancreatic cancer (92)
- Wnt signaling pathway (87)
- Toll-like receptor signaling pathway (80)
- Neurotrophin signaling pathway (79)
- T cell receptor signaling pathway (76)
- Chemokine signaling pathway (73)
- Small cell lung cancer (73)
- Acute myeloid leukemia (71)
- Huntington's disease (71)
- Jak-STAT signaling pathway (70)
- Adipocytokine signaling pathway (67)
- TGF-beta signaling pathway (67)
- B cell receptor signaling pathway (63)
- Colorectal cancer (59)
- Apoptosis (57)
- RIG-I-like receptor signaling pathway (46)
- Ubiquitin mediated proteolysis (46)
- Cytosolic DNA-sensing pathway (41)
- Thyroid cancer (38)
- Epithelial cell signaling in Helicobacter pylori infection (37)
- ErbB signaling pathway (37)
- NOD-like receptor signaling pathway (37)
- Endometrial cancer (36)
- Notch signaling pathway (32)
- p53 signaling pathway (31)
- Adherens junction (30)
- Non-small cell lung cancer (30)
- Renal cell carcinoma (30)
- Basal transcription factors (28)
- Bladder cancer (28)
- Melanogenesis (28)
- Melanoma (28)
- Basal cell carcinoma (27)
- Amyotrophic lateral sclerosis (ALS) (26)
- Maturity onset diabetes of the young (26)
- Metabolic pathways (26)
- Oocyte meiosis (26)
- Tight junction (25)
- Glioma (24)
- Focal adhesion (23)
- Insulin signaling pathway (23)
- Antigen processing and presentation (21)
- GnRH signaling pathway (20)
- DNA replication (19)
- Natural killer cell mediated cytotoxicity (18)
- Endocytosis (16)
- Base excision repair (15)
- Cytokine-cytokine receptor interaction (15)
- Neuroactive ligand-receptor interaction (15)
- Systemic lupus erythematosus (15)
- Axon guidance (14)
- Alzheimer's disease (13)
- Nucleotide excision repair (12)
- PPAR signaling pathway (12)
- Pathogenic Escherichia coli infection (12)
- Type II diabetes mellitus (12)
- Viral myocarditis (12)
- Allograft rejection (11)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (11)
- Graft-versus-host disease (11)
- RNA degradation (11)
- Type I diabetes mellitus (11)
- VEGF signaling pathway (11)
- Dilated cardiomyopathy (9)
- Hypertrophic cardiomyopathy (HCM) (9)
- Fc epsilon RI signaling pathway (8)
- Leukocyte transendothelial migration (8)
- Long-term potentiation (8)
- Circadian rhythm - mammal (7)
- Glycolysis / Gluconeogenesis (7)
- Long-term depression (7)
- Non-homologous end-joining (7)
- mTOR signaling pathway (7)
- Asthma (6)
- Dorso-ventral axis formation (6)
- Hematopoietic cell lineage (6)
- Purine metabolism (6)
- Pyrimidine metabolism (6)
- Spliceosome (6)
- Vascular smooth muscle contraction (6)
- Autoimmune thyroid disease (5)
- Cell adhesion molecules (CAMs) (5)
- Cysteine and methionine metabolism (5)
- Primary immunodeficiency (5)
- Prion diseases (5)
- Homologous recombination (4)
- RNA polymerase (4)
- Fc gamma R-mediated phagocytosis (3)
- Hedgehog signaling pathway (3)
- Regulation of actin cytoskeleton (3)
- Biosynthesis of unsaturated fatty acids (2)
- Calcium signaling pathway (2)
- Progesterone-mediated oocyte maturation (2)
- Proteasome (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Lysine degradation (1)
- Ribosome (1)
- serine and threonine metabolism (1)