Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal Anti-TJP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Vinculin (VCL) mouse monoclonal antibody, clone VIN-54, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Active filters
Applications
- IHC
Pathways
- Adherens junction
Filter by
Category
Target Symbol
- ERBB2 (108)
- CTNNB1 (83)
- EGFR (59)
- CDH1 (52)
- CTNND1 (33)
- MAPK1 (29)
- MET (23)
- IQGAP1 (20)
- SNAI2 (20)
- PTPN1 (16)
- SHC1 (16)
- SRC (16)
- BAIAP2 (13)
- NECTIN1 (12)
- SMAD3 (12)
- SSX2IP (12)
- SNAI1 (11)
- WASL (11)
- ACTB (9)
- ACTN1 (9)
- TGFBR2 (9)
- FGFR1 (8)
- MAPK3 (8)
- EP300 (7)
- LEF1 (7)
- ACTN2 (6)
- SMAD2 (6)
- CREBBP (5)
- IGF1R (5)
- PTPN6 (5)
- PTPRM (5)
- ACTN4 (4)
- CSNK2A1 (4)
- CTNNA1 (4)
- FYN (4)
- MAP3K7 (4)
- NECTIN2 (4)
- SMAD4 (4)
- VCL (4)
- ACTN3 (3)
- ACVR1B (3)
- ACVR1C (3)
- PTPRJ (3)
- TGFBR1 (3)
- TJP1 (3)
- WASF1 (3)
- YES1 (3)
- ACP1 (2)
- ACTG1 (2)
- FER (2)
- MLLT4 (2)
- NLK (2)
- RAC1 (2)
- RHOA (2)
- TCF7 (2)
- WASF2 (2)
- WASF3 (2)
- CDC42 (1)
- CSNK2A2 (1)
- CSNK2B (1)
- INSR (1)
- NECTIN3 (1)
- NECTIN4 (1)
- PARD3 (1)
- RAC2 (1)
- SORBS1 (1)
- TCF7L1 (1)
- WAS (1)
Reactivities
- Human (610)
- Mouse (488)
- Rat (479)
- Dog (88)
- Monkey (81)
- Bovine (17)
- Chicken (9)
- Pig (8)
- Xenopus (7)
- Rabbit (4)
- X. tropicalis (4)
- Primate (3)
- Zebrafish (3)
- Bat (2)
- Canine (2)
- Hamster (2)
- Rhesus Monkey (2)
- All Species (1)
- Avian (1)
- Chimpanzee (1)
- Gibbon (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Sheep (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (689)
- Transmembrane (318)
- Protein Kinase (295)
- ES Cell Differentiation/IPS (279)
- Transcription Factors (144)
- Stem cell relevant signaling - JAK/STAT signaling pathway (93)
- Cancer stem cells (77)
- Adult stem cells (66)
- Secreted Protein (59)
- Phosphatase (31)
- Embryonic stem cells (18)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (18)
- Stem cell - Pluripotency (5)