Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal Anti-PKLR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
USD 525.00
5 Days
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Rabbit anti-PDE4D Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDE4D |
USD 480.00
2 Weeks
Natriuretic Peptide Receptor B (NPR2) (131-231) mouse monoclonal antibody, clone 2A6, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDE7B antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Gorilla, Mouse, Rat, Elephant, Horse, Rabbit (88%); Opossum (82%). |
Rabbit polyclonal APRT Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APRT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-40 amino acids from the N-terminal region of human APRT. |
Rabbit polyclonal ITPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA. |
Rabbit Polyclonal Anti-PNPT1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED |
Active filters
Applications
- IHC
Pathways
- Purine metabolism
Filter by
Category
Target Symbol
- NME1 (137)
- PDE4A (51)
- NME4 (45)
- RRM1 (35)
- AK4 (27)
- AK5 (22)
- PDE4B (21)
- PAPSS2 (20)
- FHIT (19)
- POLR2A (17)
- DCK (13)
- RRM2 (12)
- GUK1 (11)
- PDE2A (11)
- PPAT (11)
- PDE10A (10)
- POLR3GL (10)
- NT5E (8)
- ENPP3 (7)
- NUDT9 (7)
- PDE1B (7)
- ADSL (6)
- ENTPD1 (6)
- PDE1A (6)
- PDE4D (6)
- PKM (6)
- POLR2E (6)
- CANT1 (5)
- ENTPD2 (5)
- NPR2 (5)
- PDE6G (5)
- PDE9A (5)
- PNPT1 (5)
- POLR2J2 (5)
- POLR3C (5)
- POLR3H (5)
- AK1 (4)
- ADCY1 (3)
- ADCY5 (3)
- AMPD1 (3)
- ATIC (3)
- PDE3A (3)
- PDE7B (3)
- ADA (2)
- ADCY4 (2)
- APRT (2)
- ENPP1 (2)
- ENTPD3 (2)
- ENTPD5 (2)
- GUCY1A1 (2)
- HPRT1 (2)
- IMPDH1 (2)
- ITPA (2)
- NME2 (2)
- NPR1 (2)
- NT5C1A (2)
- PAICS (2)
- PDE5A (2)
- PDE8B (2)
- PKLR (2)
- POLR3F (2)
- PRPS2 (2)
- PRUNE1 (2)
- XDH (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- AK2 (1)
- AMPD2 (1)
- ENTPD6 (1)
- GART (1)
- GMPR (1)
- GMPS (1)
- GUCY1A3 (1)
- GUCY1B1 (1)
- GUCY1B3 (1)
- GUCY2D (1)
- IMPDH2 (1)
- NME5 (1)
- NT5C (1)
- NT5C2 (1)
- PAPSS1 (1)
- PDE11A (1)
- PDE1C (1)
- PDE4C (1)
- PDE6D (1)
- PDE7A (1)
- PDE8A (1)
- POLD1 (1)
- POLE (1)
- POLE4 (1)
- POLR1B (1)
- POLR1C (1)
- POLR2B (1)
- POLR2G (1)
- POLR2J (1)
- POLR3A (1)
- PRIM1 (1)
- PRPS1 (1)