Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-WDR5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human JMJD2a (Jumonji domain containing 2a), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Active filters
Applications
- IP
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Category
Target Symbol
- LTF (8)
- MDH1 (6)
- BCHE (3)
- CA1 (3)
- COL5A1 (3)
- CP (3)
- EPHB1 (3)
- PGAM2 (3)
- PLG (3)
- ACPP (2)
- C3 (2)
- CDK1 (2)
- CTNNB1 (2)
- PPP1CC (2)
- XRCC5 (2)
- ABCF1 (1)
- AK4 (1)
- AKR1C3 (1)
- APEH (1)
- APTX (1)
- ARRB1 (1)
- BABAM2 (1)
- BAK1 (1)
- BAX (1)
- BCL2 (1)
- BCL2L1 (1)
- BMI1 (1)
- BUD23 (1)
- C5 (1)
- CACNA1B (1)
- CAV2 (1)
- CBS (1)
- CCNH (1)
- CD3E (1)
- CD40 (1)
- CDK5 (1)
- CDKN1B (1)
- CHUK (1)
- CPT1A (1)
- CTNNA1 (1)
- CTSD (1)
- CXCR2 (1)
- DBI (1)
- DCTN1 (1)
- DDB1 (1)
- DNMT3A (1)
- DUT (1)
- EED (1)
- EHMT2 (1)
- ELOB (1)
- ENO1 (1)
- EZH2 (1)
- FADD (1)
- FANCD2 (1)
- FASN (1)
- FBN2 (1)
- FBXO7 (1)
- FKBP4 (1)
- FOS (1)
- G3BP1 (1)
- GDF15 (1)
- GNAS (1)
- H2AFZ (1)
- HADHA (1)
- HDAC1 (1)
- HDAC2 (1)
- HDAC9 (1)
- HIF1AN (1)
- HK1 (1)
- HMGA2 (1)
- HMOX1 (1)
- HNMT (1)
- HNRNPUL1 (1)
- HUS1 (1)
- INSL3 (1)
- IRF3 (1)
- ITGA4 (1)
- ITGAV (1)
- JUP (1)
- KDM1A (1)
- KIF5C (1)
- KPNA2 (1)
- LITAF (1)
- MCM3 (1)
- MNAT1 (1)
- MRE11 (1)
- MTOR (1)
- NR0B1 (1)
- NR3C1 (1)
- NR4A3 (1)
- NUP62 (1)
- OPTN (1)
- PAX8 (1)
- PCK1 (1)
- PDGFRA (1)
- PDHA1 (1)
- PDIA6 (1)
- POLR2C (1)
- PPP2CA (1)
- PPP4C (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Assay Types
Pathways
- Metabolic pathways (22)
- Pathways in cancer (20)
- Focal adhesion (13)
- Cell cycle (9)
- Citrate cycle (TCA cycle) (8)
- Huntington's disease (8)
- MAPK signaling pathway (8)
- Pyruvate metabolism (8)
- Glycolysis / Gluconeogenesis (7)
- Insulin signaling pathway (7)
- Oocyte meiosis (7)
- Prostate cancer (7)
- Adipocytokine signaling pathway (6)
- Apoptosis (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Colorectal cancer (6)
- Complement and coagulation cascades (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Regulation of actin cytoskeleton (6)
- Small cell lung cancer (6)
- Toll-like receptor signaling pathway (6)
- Axon guidance (5)
- Chronic myeloid leukemia (5)
- ECM-receptor interaction (5)
- Gap junction (5)
- Leukocyte transendothelial migration (5)
- Neuroactive ligand-receptor interaction (5)
- Nucleotide excision repair (5)
- Systemic lupus erythematosus (5)
- Tight junction (5)
- Chemokine signaling pathway (4)
- Endocytosis (4)
- Pathogenic Escherichia coli infection (4)
- Porphyrin and chlorophyll metabolism (4)
- Proteasome (4)
- RIG-I-like receptor signaling pathway (4)
- T cell receptor signaling pathway (4)
- Vascular smooth muscle contraction (4)
- Wnt signaling pathway (4)
- Acute myeloid leukemia (3)
- Adherens junction (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- B cell receptor signaling pathway (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Cytokine-cytokine receptor interaction (3)
- DNA replication (3)
- Dilated cardiomyopathy (3)
- Endometrial cancer (3)
- Hematopoietic cell lineage (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Melanogenesis (3)
- Natural killer cell mediated cytotoxicity (3)
- Neurotrophin signaling pathway (3)
- Nitrogen metabolism (3)
- Non-homologous end-joining (3)
- PPAR signaling pathway (3)
- Primary immunodeficiency (3)
- Purine metabolism (3)
- Pyrimidine metabolism (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- Ubiquitin mediated proteolysis (3)
- p53 signaling pathway (3)
- Alzheimer's disease (2)
- Basal cell carcinoma (2)
- Butanoate metabolism (2)
- Cysteine and methionine metabolism (2)
- Cytosolic DNA-sensing pathway (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Fatty acid metabolism (2)
- Glioma (2)
- Histidine metabolism (2)
- Homologous recombination (2)
- Long-term depression (2)
- Long-term potentiation (2)
- Lysine degradation (2)
- Mismatch repair (2)
- NOD-like receptor signaling pathway (2)
- Notch signaling pathway (2)
- Pancreatic cancer (2)
- Prion diseases (2)
- Progesterone-mediated oocyte maturation (2)
- Riboflavin metabolism (2)
- Selenoamino acid metabolism (2)
- TGF-beta signaling pathway (2)
- Taste transduction (2)
- Valine (2)
- mTOR signaling pathway (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Arachidonic acid metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Biosynthesis of unsaturated fatty acids (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycine (1)
- GnRH signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Limonene and pinene degradation (1)
- Lysosome (1)
- Melanoma (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Non-small cell lung cancer (1)
- Propanoate metabolism (1)
- RNA degradation (1)
- RNA polymerase (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)
- serine and threonine metabolism (1)