Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Mouse Monoclonal TFRC (CD71) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
Rabbit Polyclonal Anti-USP22 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP22 antibody: synthetic peptide directed towards the middle region of human USP22. Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
USD 515.00
In Stock
Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Active filters
Families
- Protease
Filter by
Target Symbol
- UCHL1 (151)
- CFI (112)
- SENP2 (95)
- SPG7 (72)
- MMP3 (70)
- LTA4H (68)
- MGLL (68)
- FOLH1 (66)
- HP (62)
- KLK3 (62)
- DPP9 (59)
- ACY1 (56)
- DPP3 (55)
- CTSL (54)
- MMP13 (54)
- PSMA7 (53)
- NAPSA (52)
- PSMA6 (52)
- PPAT (51)
- MALT1 (50)
- USP44 (50)
- CASP3 (49)
- EPHX1 (47)
- CPA1 (45)
- MME (45)
- ENPEP (44)
- OTUB1 (44)
- CPM (43)
- OTUB2 (43)
- PSMB9 (43)
- CFLAR (41)
- NLN (41)
- MIPEP (40)
- USP7 (40)
- CLPP (38)
- PSMA2 (38)
- PSMB4 (38)
- PROZ (36)
- PSMB7 (36)
- ANPEP (34)
- C1S (33)
- CPA2 (33)
- CAPN5 (32)
- ERAP1 (32)
- MMP7 (32)
- PRTN3 (32)
- HGF (31)
- USP40 (31)
- USP5 (31)
- SIL1 (30)
- MASP2 (29)
- TMPRSS5 (29)
- AGTPBP1 (27)
- ADAMTS1 (26)
- ADAMTS4 (26)
- CASP9 (26)
- F10 (25)
- LTF (25)
- MMP2 (23)
- PSMA4 (23)
- USP36 (23)
- PGC (22)
- PLAU (22)
- UQCRC1 (22)
- C2 (21)
- CAPN9 (21)
- CPO (21)
- F12 (21)
- HABP2 (21)
- CASP8 (19)
- KYNU (19)
- MMP11 (19)
- MMP9 (19)
- CASP4 (18)
- CNDP1 (18)
- TFR2 (18)
- TFRC (18)
- USP10 (18)
- XPNPEP3 (18)
- CASP1 (17)
- CASP7 (17)
- F2 (17)
- PLG (17)
- USP13 (17)
- ACE (16)
- ATG4B (16)
- CTSD (16)
- DPP10 (16)
- F7 (16)
- GZMB (16)
- RNPEP (16)
- C1R (15)
- CASP6 (15)
- DPP4 (15)
- CNDP2 (14)
- MMP1 (14)
- SENP8 (14)
- CFB (13)
- COPS5 (13)
- KEL (13)
Reactivities
- Human (4213)
- Mouse (2224)
- Rat (2141)
- Monkey (370)
- Dog (329)
- Bovine (46)
- Pig (30)
- Cow (23)
- Rabbit (15)
- Horse (8)
- Chicken (7)
- Hamster (7)
- Canine (6)
- Gorilla (6)
- Zebrafish (6)
- Chimpanzee (5)
- Gibbon (5)
- Xenopus (5)
- Bat (4)
- Gerbil (4)
- Orang-Utan (4)
- Rhesus Monkey (4)
- Primate (3)
- Sheep (3)
- X. tropicalis (3)
- Porcine (2)
- Feline (1)
- Fish (1)
- Frog (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Complement and coagulation cascades (392)
- Metabolic pathways (355)
- Proteasome (331)
- Parkinson's disease (269)
- Alzheimer's disease (246)
- Pathways in cancer (245)
- Renin-angiotensin system (202)
- Apoptosis (195)
- Lysosome (184)
- Wnt signaling pathway (134)
- Huntington's disease (120)
- Hematopoietic cell lineage (97)
- Viral myocarditis (96)
- p53 signaling pathway (96)
- Amyotrophic lateral sclerosis (ALS) (94)
- Prostate cancer (90)
- Systemic lupus erythematosus (78)
- Colorectal cancer (77)
- Arachidonic acid metabolism (76)
- Glycerolipid metabolism (68)
- Antigen processing and presentation (67)
- Natural killer cell mediated cytotoxicity (65)
- Epithelial cell signaling in Helicobacter pylori infection (62)
- Arginine and proline metabolism (58)
- Alanine (56)
- Bladder cancer (56)
- aspartate and glutamate metabolism (56)
- Purine metabolism (51)
- B cell receptor signaling pathway (50)
- T cell receptor signaling pathway (50)
- MAPK signaling pathway (49)
- Metabolism of xenobiotics by cytochrome P450 (47)
- Glutathione metabolism (44)
- NOD-like receptor signaling pathway (44)
- Neuroactive ligand-receptor interaction (44)
- Focal adhesion (43)
- Leukocyte transendothelial migration (42)
- Cytokine-cytokine receptor interaction (31)
- Melanoma (31)
- Renal cell carcinoma (31)
- GnRH signaling pathway (30)
- Regulation of autophagy (29)
- Endometrial cancer (28)
- Non-small cell lung cancer (28)
- Pancreatic cancer (28)
- RIG-I-like receptor signaling pathway (28)
- Small cell lung cancer (28)
- VEGF signaling pathway (28)
- Cardiac muscle contraction (24)
- Oxidative phosphorylation (24)
- Endocytosis (20)
- Toll-like receptor signaling pathway (19)
- Tryptophan metabolism (19)
- Type I diabetes mellitus (19)
- Histidine metabolism (18)
- Notch signaling pathway (18)
- beta-Alanine metabolism (18)
- Cytosolic DNA-sensing pathway (17)
- Regulation of actin cytoskeleton (17)
- Allograft rejection (16)
- Autoimmune thyroid disease (16)
- Graft-versus-host disease (16)
- Hypertrophic cardiomyopathy (HCM) (16)
- PPAR signaling pathway (14)
- Protein export (10)
- Cyanoamino acid metabolism (8)
- Selenoamino acid metabolism (8)
- Taurine and hypotaurine metabolism (8)
- Basal transcription factors (7)
- Neurotrophin signaling pathway (7)
- Hedgehog signaling pathway (6)
- Amino sugar and nucleotide sugar metabolism (5)
- Cell cycle (5)
- Folate biosynthesis (5)
- Oocyte meiosis (5)
- Other glycan degradation (4)
- Spliceosome (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)