Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Goat Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Active filters
Pathways
- Cell cycle
Filter by
Target Symbol
- TP53 (255)
- CDKN2A (198)
- GADD45G (134)
- MDM2 (121)
- PCNA (121)
- CDK2 (63)
- BUB1B (62)
- CHEK2 (61)
- MYC (61)
- MCM2 (59)
- RB1 (59)
- CDKN2C (52)
- PLK1 (52)
- HDAC1 (49)
- SMC1A (47)
- CCND2 (42)
- CCND1 (37)
- CDKN1A (36)
- CDKN2B (36)
- SMAD2 (34)
- ANAPC11 (33)
- ANAPC2 (31)
- CDC6 (28)
- CHEK1 (26)
- HDAC2 (26)
- ZBTB17 (25)
- CDC25A (24)
- SMAD3 (24)
- CCNB1 (23)
- CDK1 (23)
- TGFB1 (22)
- ABL1 (21)
- GSK3B (20)
- CDC25B (19)
- PKMYT1 (19)
- RAD21 (19)
- E2F5 (18)
- PRKDC (17)
- CDKN1B (16)
- E2F4 (16)
- MCM5 (16)
- YWHAZ (16)
- GADD45A (15)
- MAD2L1 (15)
- TTK (14)
- CCNH (13)
- TFDP2 (13)
- YWHAB (13)
- CCNE1 (12)
- CDC45 (12)
- E2F1 (12)
- EP300 (12)
- RBL1 (12)
- CDK7 (11)
- YWHAG (11)
- CDC25C (10)
- CDK6 (10)
- MCM7 (10)
- ATM (9)
- CCNA1 (9)
- CDC16 (9)
- CDK4 (9)
- E2F2 (9)
- SMAD4 (9)
- TFDP1 (9)
- YWHAQ (9)
- ANAPC1 (8)
- CCNA2 (8)
- CCND3 (8)
- CDC27 (8)
- SFN (8)
- TGFB2 (8)
- BUB3 (7)
- CDKN1C (7)
- CREBBP (7)
- CUL1 (7)
- MCM3 (7)
- YWHAE (7)
- ANAPC5 (6)
- BUB1 (6)
- CCNE2 (6)
- CDC2 (6)
- CDC20 (6)
- CDC23 (6)
- MCM6 (6)
- PTTG1 (6)
- RBL2 (6)
- SKP2 (6)
- ANAPC10 (5)
- ATR (5)
- CCNB2 (5)
- CDC7 (5)
- DCLRE1C (5)
- ESPL1 (5)
- SKP1 (5)
- STAG2 (5)
- TGFB3 (5)
- ANAPC4 (4)
- MAD1L1 (4)
- MCM4 (4)
Reactivities
- Human (2347)
- Mouse (1458)
- Rat (1300)
- Monkey (170)
- Dog (92)
- Bovine (36)
- Chicken (18)
- Pig (17)
- Cow (10)
- Xenopus (9)
- Zebrafish (7)
- Frog (6)
- Rhesus Monkey (6)
- Canine (5)
- Chimpanzee (5)
- Primate (5)
- Drosophila (4)
- Hamster (4)
- Feline (3)
- X. tropicalis (3)
- Yeast (3)
- Fish (2)
- Mammalian (2)
- Rabbit (2)
- Algal (1)
- Amphibian (1)
- Equine (1)
- Insect (1)
- Opossum (1)
- Porcine (1)
- Saccharomyces cerevisiae (1)
- Sheep (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2334)
- Transcription Factors (978)
- Stem cell - Pluripotency (938)
- Protein Kinase (441)
- Stem cell relevant signaling - JAK/STAT signaling pathway (156)
- Embryonic stem cells (119)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (119)
- Stem cell relevant signaling - DSL/Notch pathway (98)
- Stem cell relevant signaling - Wnt Signaling pathway (98)
- ES Cell Differentiation/IPS (80)
- Induced pluripotent stem cells (61)
- Cancer stem cells (58)
- Phosphatase (55)
- Adult stem cells (49)
- Secreted Protein (43)
- Transmembrane (13)
- Protease (5)