Products

View as table Download

Rabbit Monoclonal antibody against CD317 / BST2

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated

Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction

Applications Assay, CT, FC, FN, IHC, IP
Reactivities Mouse, Rat
Immunogen Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant.

Rabbit Monoclonal Antibody against S100B (Clone EP1576Y)

Applications Assay, IHC, WB
Reactivities Mouse, Rat, Goat, Human, ZebraFish, Macaque Monkey

Rabbit Monoclonal antibody against AGL

Applications Assay, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Monoclonal antibody against PMP70

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit Monoclonal antibody against EEF1G

Applications Assay, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Monoclonal antibody against IL-11R alpha (IL11RA)

Applications Assay, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Monoclonal antibody against MGEA5

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Monoclonal antibody against CD205

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Monoclonal Antibody against CD5 (Clone EP2952)

Applications Assay, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Monoclonal antibody against POT1

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

Rabbit Monoclonal antibody against Oncomodulin (OCM2)

Applications Assay, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)

Applications Assay, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07)

Rabbit Polyclonal Anti-KLF2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP

Rabbit Polyclonal HDAC1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
Immunogen The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide.

Mouse Monoclonal H3K4me1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

RAD54 (RAD54L) (1-17) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Human
Immunogen Synthetic peptide corresponding aa 1-17 of Human RAD54 protein.

swi6 (314-328) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein

MTOR (2440-2457) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Canine, Human, Mouse, Zebrafish
Immunogen Synthetic peptide corresponding to amino acids 2440-2457 of human mTOR

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Rabbit Polyclonal Anti-TAF1 Antibody

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Rabbit Polyclonal Anti-SUZ12 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit Polyclonal Anti-MED17 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG

Rabbit Polyclonal Anti-SMARCA1 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE

Rabbit Polyclonal Anti-TAF9 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Rabbit Polyclonal Anti-Hdac6 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM

Flunixin (COOH) sheep polyclonal antibody, Ig Fraction

Applications Assay, ELISA
Immunogen Flunixin(COOH)-BTG