Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Active filters
Reactivities
- Mouse
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (84)
- OTC (71)
- PIK3C2A (43)
- ABAT (36)
- AKR1A1 (31)
- LTA4H (31)
- PFKP (31)
- TYMS (30)
- GCH1 (29)
- ACAT2 (27)
- ACAA2 (26)
- HADH (25)
- UPRT (24)
- RRM1 (23)
- TH (22)
- ACY1 (21)
- CMPK1 (21)
- GBA (19)
- GBE1 (18)
- GPI (18)
- PNMT (18)
- AK4 (17)
- RPN1 (16)
- AMDHD1 (15)
- CYP2A6 (15)
- GRHPR (15)
- LDHA (15)
- NNMT (15)
- AK5 (14)
- ALOX5 (14)
- DLD (14)
- GAPDH (14)
- SDHB (14)
- GAD1 (13)
- ACSS2 (12)
- ALDH1A3 (12)
- DDOST (12)
- HSD17B4 (12)
- OXSM (12)
- PAPSS2 (12)
- PYCR2 (12)
- SMS (12)
- CAT (11)
- HSD17B10 (11)
- NDUFB9 (11)
- ADH5 (10)
- BDH2 (10)
- BHMT (10)
- CPS1 (10)
- ENO2 (10)
- IDH1 (10)
- POLR2A (10)
- SHMT2 (10)
- TALDO1 (10)
- ACADM (9)
- ALDOB (9)
- ASS1 (9)
- ATP6V1C2 (9)
- GLUL (9)
- IDS (9)
- NANP (9)
- PGAM2 (9)
- PISD (9)
- POLR3GL (9)
- FH (8)
- GALNT10 (8)
- GLS2 (8)
- NDUFS2 (8)
- PIKFYVE (8)
- TYR (8)
- ARG1 (7)
- ASL (7)
- ATP6V1B1 (7)
- COX17 (7)
- DHFR (7)
- GCK (7)
- GUK1 (7)
- HSD17B8 (7)
- PPAT (7)
- RRM2 (7)
- SCP2 (7)
- ACO2 (6)
- ADH7 (6)
- ALDH7A1 (6)
- ALOX12 (6)
- ATP6V1F (6)
- COASY (6)
- CTH (6)
- FDFT1 (6)
- GATM (6)
- GSS (6)
- HAO1 (6)
- HMBS (6)
- MAOA (6)
- MMAB (6)
- NDUFA4L2 (6)
- NDUFB10 (6)
- PAFAH1B3 (6)
- PANK2 (6)
- PDXK (6)