Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-NES Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- ABCB1 (85)
- CTNNB1 (71)
- AKT1 (64)
- JUN (63)
- NCAM1 (55)
- BCL2 (51)
- PIK3CG (51)
- L1CAM (42)
- GLI1 (39)
- ID3 (36)
- NKX2-1 (34)
- EGFR (33)
- STAT5A (32)
- NEUROG1 (31)
- TNNI3 (31)
- GFAP (30)
- VIM (30)
- MAPK9 (27)
- SMAD1 (25)
- HES1 (24)
- HGF (22)
- GATA3 (21)
- LHX1 (21)
- NOTCH1 (20)
- CDX2 (19)
- FN1 (18)
- GAPDH (18)
- BCL2L1 (16)
- DVL2 (16)
- CDH2 (15)
- IRF6 (15)
- PDGFRA (15)
- CASP3 (14)
- MAPK8 (13)
- PDX1 (13)
- YBX1 (13)
- ID2 (12)
- IGF1 (12)
- ITGB3 (12)
- KLF5 (12)
- SOX9 (12)
- TRIM33 (12)
- GLI2 (11)
- AKT2 (9)
- AKT3 (9)
- FOXA2 (9)
- JAG1 (9)
- PDGFRB (8)
- SMAD3 (8)
- ACTN1 (7)
- ANGPT1 (7)
- BDNF (7)
- MAPK3 (7)
- NT5E (7)
- SMURF2 (7)
- SOX2 (7)
- STAT5B (7)
- ACTB (6)
- ENPEP (6)
- GATA4 (6)
- GCG (6)
- HNF4A (6)
- KDR (6)
- LEF1 (6)
- MAPK6 (6)
- PRKCA (6)
- SRC (6)
- CXCR4 (5)
- DLX1 (5)
- HOXD8 (5)
- NEFL (5)
- ONECUT1 (5)
- PTCH1 (5)
- SHH (5)
- TAL1 (5)
- ZFP57 (5)
- ALDH1A1 (4)
- CD44 (4)
- CDH1 (4)
- ITGAM (4)
- KLF4 (4)
- PAX3 (4)
- SLC2A1 (4)
- TCF3 (4)
- TTR (4)
- ANPEP (3)
- CDH5 (3)
- CEBPA (3)
- CSNK1A1 (3)
- CSNK2A1 (3)
- CXCL12 (3)
- CYP3A4 (3)
- DDX3X (3)
- DLX5 (3)
- HNF1A (3)
- HNF1B (3)
- ID4 (3)
- JMJD6 (3)
- LAMA1 (3)
- LAMP1 (3)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (695)
- Focal adhesion (530)
- Colorectal cancer (476)
- Prostate cancer (340)
- ErbB signaling pathway (329)
- Neurotrophin signaling pathway (301)
- MAPK signaling pathway (286)
- Endometrial cancer (260)
- Pancreatic cancer (244)
- Toll-like receptor signaling pathway (243)
- Melanoma (242)
- Wnt signaling pathway (242)
- T cell receptor signaling pathway (233)
- Renal cell carcinoma (232)
- Small cell lung cancer (226)
- Glioma (216)
- Apoptosis (215)
- Chronic myeloid leukemia (207)
- B cell receptor signaling pathway (204)
- Jak-STAT signaling pathway (201)
- Acute myeloid leukemia (193)
- Progesterone-mediated oocyte maturation (193)
- Fc epsilon RI signaling pathway (186)
- Insulin signaling pathway (182)
- Non-small cell lung cancer (181)
- Tight junction (181)
- Regulation of actin cytoskeleton (177)
- Basal cell carcinoma (173)
- Leukocyte transendothelial migration (168)
- VEGF signaling pathway (158)
- Chemokine signaling pathway (156)
- Epithelial cell signaling in Helicobacter pylori infection (156)
- Adherens junction (155)
- GnRH signaling pathway (155)
- mTOR signaling pathway (153)
- Cell adhesion molecules (CAMs) (150)
- Fc gamma R-mediated phagocytosis (148)
- Adipocytokine signaling pathway (127)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (122)
- Melanogenesis (121)
- Cytokine-cytokine receptor interaction (119)
- TGF-beta signaling pathway (113)
- Type II diabetes mellitus (113)
- Pathogenic Escherichia coli infection (91)
- Thyroid cancer (88)
- ABC transporters (87)
- Amyotrophic lateral sclerosis (ALS) (86)
- Natural killer cell mediated cytotoxicity (84)
- Prion diseases (84)
- Endocytosis (81)
- Gap junction (80)
- Hedgehog signaling pathway (80)
- Notch signaling pathway (77)
- Hypertrophic cardiomyopathy (HCM) (70)
- Dilated cardiomyopathy (69)
- Maturity onset diabetes of the young (67)
- Calcium signaling pathway (63)
- Dorso-ventral axis formation (60)
- Axon guidance (59)
- Phosphatidylinositol signaling system (57)
- Inositol phosphate metabolism (51)
- NOD-like receptor signaling pathway (47)
- Bladder cancer (46)
- ECM-receptor interaction (46)
- RIG-I-like receptor signaling pathway (43)
- Alzheimer's disease (42)
- Hematopoietic cell lineage (42)
- Metabolic pathways (41)
- Cardiac muscle contraction (31)
- Viral myocarditis (30)
- p53 signaling pathway (27)
- Long-term depression (25)
- Huntington's disease (23)
- Oocyte meiosis (20)
- Glycolysis / Gluconeogenesis (19)
- Parkinson's disease (14)
- Cell cycle (13)
- Long-term potentiation (13)
- Vascular smooth muscle contraction (13)
- Vibrio cholerae infection (12)
- Renin-angiotensin system (10)
- Antigen processing and presentation (9)
- Autoimmune thyroid disease (9)
- Type I diabetes mellitus (9)
- Allograft rejection (8)
- Graft-versus-host disease (8)
- Nicotinate and nicotinamide metabolism (8)
- Purine metabolism (7)
- Pyrimidine metabolism (7)
- Retinol metabolism (7)
- Systemic lupus erythematosus (7)
- Ubiquitin mediated proteolysis (7)
- Neuroactive ligand-receptor interaction (6)
- Complement and coagulation cascades (5)
- Lysosome (4)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Primary immunodeficiency (3)
- PPAR signaling pathway (2)
- Tyrosine metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- Fructose and mannose metabolism (1)
- Oxidative phosphorylation (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Primary bile acid biosynthesis (1)
- Pyruvate metabolism (1)
- Regulation of autophagy (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)