Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
.jpg?d=110x100 "User supplied image")
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRDX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Active filters
Reactivities
- Rat
Applications
- IHC
Citations
- Yes
Filter by
Target Symbol
- VIM (7)
- LGR5 (6)
- CDH2 (5)
- ZEB1 (5)
- ALDH1A3 (4)
- BAX (4)
- BECN1 (4)
- CTNNB1 (4)
- GAPDH (4)
- GBE1 (4)
- LTA4H (4)
- MAPK1 (4)
- NIT2 (4)
- PDE10A (4)
- PRRX1 (4)
- SAMHD1 (4)
- SLC7A8 (4)
- SNAI2 (4)
- UNG (4)
- ALK (3)
- BCL2 (3)
- EPAS1 (3)
- ERBB2 (3)
- HNRNPM (3)
- HSPD1 (3)
- KRT18 (3)
- KRT8 (3)
- MME (3)
- NCAM1 (3)
- NR4A3 (3)
- PARP1 (3)
- PPP4C (3)
- RELA (3)
- SLC18A2 (3)
- SOX17 (3)
- STAT3 (3)
- TMEM100 (3)
- ABCC4 (2)
- ABCD1 (2)
- ACAA2 (2)
- ACTN1 (2)
- ADH1B (2)
- AKT1 (2)
- AKT3 (2)
- ANXA1 (2)
- ANXA3 (2)
- AOX1 (2)
- APMAP (2)
- APPL1 (2)
- AQP1 (2)
- ARNT (2)
- ARNTL (2)
- B3GNT2 (2)
- BAG3 (2)
- BCL2L1 (2)
- BDNF (2)
- BTK (2)
- CAT (2)
- CDX2 (2)
- CMPK1 (2)
- CNN2 (2)
- COMMD1 (2)
- CTSD (2)
- CYP2A6 (2)
- CYP2B6 (2)
- DCK (2)
- DCPS (2)
- DIRAS2 (2)
- DNAJB1 (2)
- DNM1L (2)
- DPP4 (2)
- DPP8 (2)
- EGR2 (2)
- ELAVL1 (2)
- ESR1 (2)
- ETS2 (2)
- EZH2 (2)
- FBXW7 (2)
- FGF2 (2)
- FGFR2 (2)
- FGFR3 (2)
- FMR1 (2)
- FN1 (2)
- FOSL1 (2)
- FOXP3 (2)
- GAD1 (2)
- GADD45G (2)
- GATA4 (2)
- GBA (2)
- GLUL (2)
- HID1 (2)
- HOXD10 (2)
- HSD17B4 (2)
- HSPA1A (2)
- HSPBP1 (2)
- IFIT1 (2)
- IGF2BP2 (2)
- KEAP1 (2)
- KRT14 (2)
- KRT5 (2)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (439)
- Transmembrane (152)
- Transcription Factors (108)
- ES Cell Differentiation/IPS (76)
- Protein Kinase (58)
- Secreted Protein (53)
- Protease (29)
- Stem cell - Pluripotency (25)
- Adult stem cells (16)
- GPCR (15)
- Embryonic stem cells (12)
- Induced pluripotent stem cells (11)
- Phosphatase (9)
- P450 (8)
- Nuclear Hormone Receptor (7)
- Cancer stem cells (6)
- Ion Channels: Other (4)
- Ion Channels: Transient receptor potential (3)
- Stem cell relevant signaling - DSL/Notch pathway (3)
- Stem cell relevant signaling - JAK/STAT signaling pathway (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Potassium (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
Pathways
- Pathways in cancer (90)
- Metabolic pathways (75)
- Focal adhesion (51)
- MAPK signaling pathway (48)
- Neurotrophin signaling pathway (38)
- Prostate cancer (38)
- Regulation of actin cytoskeleton (35)
- Colorectal cancer (34)
- Adherens junction (33)
- Pancreatic cancer (32)
- Chemokine signaling pathway (30)
- Renal cell carcinoma (28)
- Apoptosis (26)
- Chronic myeloid leukemia (26)
- Small cell lung cancer (26)
- ErbB signaling pathway (25)
- Insulin signaling pathway (25)
- Endometrial cancer (24)
- Toll-like receptor signaling pathway (24)
- Acute myeloid leukemia (23)
- Endocytosis (23)
- Melanoma (23)
- Progesterone-mediated oocyte maturation (23)
- T cell receptor signaling pathway (23)
- Alzheimer's disease (22)
- Glioma (22)
- B cell receptor signaling pathway (21)
- Prion diseases (21)
- Axon guidance (20)
- Non-small cell lung cancer (19)
- Tight junction (19)
- VEGF signaling pathway (19)
- Bladder cancer (18)
- Cell adhesion molecules (CAMs) (18)
- Fc epsilon RI signaling pathway (18)
- Fc gamma R-mediated phagocytosis (18)
- Huntington's disease (18)
- Adipocytokine signaling pathway (17)
- Gap junction (17)
- Natural killer cell mediated cytotoxicity (17)
- Jak-STAT signaling pathway (16)
- Purine metabolism (16)
- Thyroid cancer (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (15)
- GnRH signaling pathway (15)
- Leukocyte transendothelial migration (15)
- Melanogenesis (15)
- NOD-like receptor signaling pathway (15)
- Amyotrophic lateral sclerosis (ALS) (14)
- Drug metabolism - cytochrome P450 (14)
- TGF-beta signaling pathway (14)
- Ubiquitin mediated proteolysis (14)
- p53 signaling pathway (14)
- Cytokine-cytokine receptor interaction (13)
- Dorso-ventral axis formation (13)
- ECM-receptor interaction (13)
- Glycolysis / Gluconeogenesis (13)
- Pathogenic Escherichia coli infection (13)
- Type II diabetes mellitus (13)
- Parkinson's disease (12)
- Vascular smooth muscle contraction (12)
- mTOR signaling pathway (12)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Long-term depression (11)
- Long-term potentiation (11)
- Oocyte meiosis (11)
- Tyrosine metabolism (11)
- Wnt signaling pathway (11)
- Arachidonic acid metabolism (10)
- Base excision repair (10)
- Calcium signaling pathway (10)
- Metabolism of xenobiotics by cytochrome P450 (10)
- Cytosolic DNA-sensing pathway (9)
- Dilated cardiomyopathy (9)
- RIG-I-like receptor signaling pathway (9)
- Type I diabetes mellitus (9)
- Hematopoietic cell lineage (8)
- Hypertrophic cardiomyopathy (HCM) (8)
- Pyrimidine metabolism (8)
- Retinol metabolism (8)
- Viral myocarditis (8)
- Alanine (7)
- Antigen processing and presentation (7)
- Basal cell carcinoma (7)
- Lysosome (7)
- Neuroactive ligand-receptor interaction (7)
- Primary immunodeficiency (7)
- aspartate and glutamate metabolism (7)
- ABC transporters (6)
- Cardiac muscle contraction (6)
- Cell cycle (6)
- Histidine metabolism (6)
- Regulation of autophagy (6)
- Spliceosome (6)
- Tryptophan metabolism (6)
- Arginine and proline metabolism (5)
- Fatty acid metabolism (5)
- Oxidative phosphorylation (5)
- RNA degradation (5)
- Starch and sucrose metabolism (5)
- Valine (5)
- leucine and isoleucine degradation (5)
- Citrate cycle (TCA cycle) (4)
- Graft-versus-host disease (4)
- Inositol phosphate metabolism (4)
- Phenylalanine metabolism (4)
- Phosphatidylinositol signaling system (4)
- Renin-angiotensin system (4)
- beta-Alanine metabolism (4)
- Allograft rejection (3)
- Androgen and estrogen metabolism (3)
- Autoimmune thyroid disease (3)
- Drug metabolism - other enzymes (3)
- Fructose and mannose metabolism (3)
- Glutathione metabolism (3)
- Hedgehog signaling pathway (3)
- Methane metabolism (3)
- One carbon pool by folate (3)
- Sphingolipid metabolism (3)
- Vibrio cholerae infection (3)
- Butanoate metabolism (2)
- Caffeine metabolism (2)
- Circadian rhythm - mammal (2)
- Complement and coagulation cascades (2)
- Cysteine and methionine metabolism (2)
- Fatty acid elongation in mitochondria (2)
- Galactose metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Homologous recombination (2)
- Keratan sulfate biosynthesis (2)
- Maturity onset diabetes of the young (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Nitrogen metabolism (2)
- Notch signaling pathway (2)
- Nucleotide excision repair (2)
- Other glycan degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose phosphate pathway (2)
- Porphyrin and chlorophyll metabolism (2)
- Primary bile acid biosynthesis (2)
- SNARE interactions in vesicular transport (2)
- Selenoamino acid metabolism (2)
- Systemic lupus erythematosus (2)
- Taurine and hypotaurine metabolism (2)
- Vitamin B6 metabolism (2)
- DNA replication (1)
- Folate biosynthesis (1)
- Glycerophospholipid metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- Propanoate metabolism (1)