Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-PSMD7 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMD7 |
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Rabbit Polyclonal Anti-MMP12 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MMP12 |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Rabbit Polyclonal Anti-USP25 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | USP25 antibody was raised against a 17 amino acid peptide near the center of human USP25. |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Rabbit polyclonal anti-MBTPS1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
CASP7 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP7 |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
Rabbit Polyclonal Anti-F2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Rabbit Polyclonal TACE Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP3 |
Rabbit anti-KLK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLK1 |
Rabbit Polyclonal Anti-MMP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
Rabbit polyclonal MMP-2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-2. |
Rabbit anti-GZMB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GZMB |
Rabbit Polyclonal Anti-USP22 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP22 antibody: synthetic peptide directed towards the middle region of human USP22. Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
Rabbit Polyclonal Anti-CAPN7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAPN7 |
Rabbit Polyclonal Anti-CFLAR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CFLAR |
Goat Polyclonal Anti-Cathepsin D Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit Polyclonal Anti-UBIAD1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UBIAD1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human UBIAD1. |
Rabbit Polyclonal Anti-NOSTRIN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NOSTRIN antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NOSTRIN. |
Rabbit Polyclonal Anti-LIMA1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LIMA1 antibody was raised against an 18 amino acid peptide near the amino terminus of human LIMA1 |
Rabbit Polyclonal Anti-DTX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DTX4 antibody was raised against a 19 amino acid peptide near the center of human DTX4. |
Rabbit Polyclonal Anti-ATG4B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B. |
Rabbit Polyclonal Anti-ATG4D Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG4D antibody was raised against a 17 amino acid peptide near the amino terminus of human ATG4D. |
USD 515.00
In Stock
Rabbit Monoclonal antibody against KLKB1
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-IDE Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IDE |
Rabbit anti-PA2G4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PA2G4 |
Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal Anti-PSMA1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
Rabbit Polyclonal Anti-FAP-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Goat Polyclonal Anti-Cathepsin D Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit anti-PSMB5 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMB5 |
Rabbit anti-PSMB2 Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMB2 |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-XPNPEP3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XPNPEP3 antibody: synthetic peptide directed towards the N terminal of human XPNPEP3. Synthetic peptide located within the following region: PVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQ |
Rabbit Polyclonal Anti-CNDP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: LAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGA |
Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |