Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (47)
- EGFR (29)
- MAPT (29)
- JUN (21)
- RELA (21)
- IRS1 (20)
- ATF2 (19)
- CREB1 (19)
- CTNNB1 (19)
- CDC25A (18)
- EZR (18)
- SMAD3 (18)
- STAT1 (17)
- TP53 (17)
- NFKBIA (16)
- RPS6KB1 (16)
- ERBB2 (15)
- JAK2 (15)
- MAPK14 (15)
- PRKCD (15)
- RAF1 (15)
- SMAD2 (15)
- STAT3 (15)
- FOXO1 (14)
- HDAC2 (14)
- IGF1R (14)
- SMAD1 (14)
- SNCA (14)
- BAX (13)
- CHUK (13)
- GJA1 (13)
- HDAC1 (13)
- MAPK1 (13)
- PAK1 (13)
- PTPN11 (13)
- SRC (13)
- TH (13)
- APP (12)
- CCNB1 (12)
- DOK1 (12)
- GSK3B (12)
- IKBKB (12)
- KDR (12)
- MET (12)
- NR3C1 (12)
- PTK2 (12)
- PXN (12)
- RB1 (12)
- STAT5B (12)
- SYK (12)
- BAD (11)
- CASP3 (11)
- CHEK2 (11)
- GRIN1 (11)
- GSK3A (11)
- HSP90AB1 (11)
- MAP2K1 (11)
- MAP3K7 (11)
- MAPK8 (11)
- NOS3 (11)
- NTRK2 (11)
- ROCK2 (11)
- BCL2L1 (10)
- BRAF (10)
- CASP9 (10)
- CDK2 (10)
- ESR1 (10)
- FGFR1 (10)
- FOS (10)
- GRIN2B (10)
- LCK (10)
- LRRK2 (10)
- MAP2K6 (10)
- MAPK3 (10)
- PDGFRB (10)
- PLCG1 (10)
- PRKAA1 (10)
- PRKCA (10)
- PRKD1 (10)
- RUNX1 (10)
- STAT5A (10)
- VASP (10)
- BCL2L11 (9)
- CASP6 (9)
- CFL1 (9)
- CSF1R (9)
- DNM1 (9)
- DPYSL2 (9)
- ELK1 (9)
- GAB2 (9)
- HSPD1 (9)
- JUND (9)
- PDCD4 (9)
- PPP1R1B (9)
- PTEN (9)
- SOCS1 (9)
- VCL (9)
- ZAP70 (9)
- ADD1 (8)
- BCAR1 (8)
Applications
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (1234)
- MAPK signaling pathway (781)
- Focal adhesion (698)
- Metabolic pathways (580)
- Neurotrophin signaling pathway (573)
- Chemokine signaling pathway (555)
- Prostate cancer (549)
- Colorectal cancer (508)
- ErbB signaling pathway (490)
- Regulation of actin cytoskeleton (485)
- Pancreatic cancer (473)
- Chronic myeloid leukemia (464)
- T cell receptor signaling pathway (440)
- Insulin signaling pathway (438)
- Neuroactive ligand-receptor interaction (420)
- Cytokine-cytokine receptor interaction (386)
- Toll-like receptor signaling pathway (379)
- Wnt signaling pathway (371)
- Cell cycle (362)
- Apoptosis (353)
- Glioma (350)
- Small cell lung cancer (349)
- Calcium signaling pathway (346)
- Melanoma (344)
- Acute myeloid leukemia (341)
- Endometrial cancer (341)
- B cell receptor signaling pathway (337)
- Jak-STAT signaling pathway (337)
- Progesterone-mediated oocyte maturation (335)
- Adipocytokine signaling pathway (334)
- Fc gamma R-mediated phagocytosis (332)
- Adherens junction (323)
- Non-small cell lung cancer (320)
- GnRH signaling pathway (314)
- Leukocyte transendothelial migration (311)
- Renal cell carcinoma (311)
- VEGF signaling pathway (311)
- Fc epsilon RI signaling pathway (306)
- Alzheimer's disease (300)
- Endocytosis (293)
- Natural killer cell mediated cytotoxicity (285)
- Epithelial cell signaling in Helicobacter pylori infection (280)
- Gap junction (275)
- Axon guidance (268)
- TGF-beta signaling pathway (251)
- Melanogenesis (247)
- Tight junction (246)
- Amyotrophic lateral sclerosis (ALS) (243)
- Bladder cancer (232)
- Huntington's disease (230)
- Vascular smooth muscle contraction (228)
- Oocyte meiosis (226)
- p53 signaling pathway (220)
- Long-term potentiation (217)
- NOD-like receptor signaling pathway (209)
- Long-term depression (197)
- mTOR signaling pathway (180)
- Type II diabetes mellitus (176)
- RIG-I-like receptor signaling pathway (166)
- Pathogenic Escherichia coli infection (158)
- Thyroid cancer (143)
- Hypertrophic cardiomyopathy (HCM) (124)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (122)
- Dilated cardiomyopathy (122)
- Parkinson's disease (116)
- Ubiquitin mediated proteolysis (111)
- Basal cell carcinoma (109)
- Cell adhesion molecules (CAMs) (104)
- Hematopoietic cell lineage (103)
- Prion diseases (95)
- Cytosolic DNA-sensing pathway (92)
- Purine metabolism (88)
- Glycolysis / Gluconeogenesis (87)
- Phosphatidylinositol signaling system (86)
- Dorso-ventral axis formation (84)
- Viral myocarditis (84)
- ECM-receptor interaction (83)
- Notch signaling pathway (78)
- PPAR signaling pathway (74)
- Vibrio cholerae infection (71)
- Antigen processing and presentation (70)
- Complement and coagulation cascades (66)
- Primary immunodeficiency (64)
- Arginine and proline metabolism (60)
- Hedgehog signaling pathway (60)
- Base excision repair (55)
- Tyrosine metabolism (53)
- ABC transporters (52)
- Inositol phosphate metabolism (52)
- Lysosome (50)
- Fructose and mannose metabolism (48)
- Type I diabetes mellitus (48)
- Pyruvate metabolism (47)
- Metabolism of xenobiotics by cytochrome P450 (45)
- Drug metabolism - cytochrome P450 (43)
- Nucleotide excision repair (42)
- Systemic lupus erythematosus (41)
- Tryptophan metabolism (41)
- Retinol metabolism (39)
- Alanine (38)
- Butanoate metabolism (38)
- aspartate and glutamate metabolism (38)
- Olfactory transduction (37)
- Valine (37)
- Cardiac muscle contraction (36)
- Fatty acid metabolism (36)
- Maturity onset diabetes of the young (36)
- Glycerolipid metabolism (35)
- Regulation of autophagy (34)
- Citrate cycle (TCA cycle) (33)
- Pyrimidine metabolism (33)
- leucine and isoleucine degradation (33)
- Homologous recombination (32)
- Renin-angiotensin system (32)
- Arachidonic acid metabolism (31)
- DNA replication (31)
- Mismatch repair (31)
- Proteasome (31)
- Cysteine and methionine metabolism (30)
- Taste transduction (30)
- Galactose metabolism (28)
- SNARE interactions in vesicular transport (28)
- Pentose phosphate pathway (27)
- Glutathione metabolism (26)
- Propanoate metabolism (24)
- Allograft rejection (22)
- Histidine metabolism (22)
- Nitrogen metabolism (22)
- Amino sugar and nucleotide sugar metabolism (21)
- Drug metabolism - other enzymes (21)
- Phenylalanine metabolism (21)
- Starch and sucrose metabolism (21)
- beta-Alanine metabolism (21)
- Autoimmune thyroid disease (20)
- Graft-versus-host disease (20)
- Lysine degradation (20)
- Androgen and estrogen metabolism (19)
- Glycerophospholipid metabolism (19)
- Glycine (19)
- serine and threonine metabolism (19)
- Non-homologous end-joining (18)
- Oxidative phosphorylation (18)
- Sphingolipid metabolism (18)
- Porphyrin and chlorophyll metabolism (15)
- RNA degradation (14)
- Nicotinate and nicotinamide metabolism (13)
- Linoleic acid metabolism (12)
- Taurine and hypotaurine metabolism (12)
- Folate biosynthesis (11)
- Ribosome (11)
- Asthma (10)
- Methane metabolism (10)
- Pentose and glucuronate interconversions (10)
- Circadian rhythm - mammal (9)
- Ether lipid metabolism (9)
- Glycosaminoglycan degradation (9)
- Glyoxylate and dicarboxylate metabolism (9)
- Riboflavin metabolism (9)
- Ascorbate and aldarate metabolism (8)
- Basal transcription factors (8)
- Selenoamino acid metabolism (8)
- Synthesis and degradation of ketone bodies (8)
- Terpenoid backbone biosynthesis (8)
- Fatty acid biosynthesis (7)
- Limonene and pinene degradation (7)
- Spliceosome (7)
- C21-Steroid hormone metabolism (6)
- Biosynthesis of unsaturated fatty acids (5)
- N-Glycan biosynthesis (5)
- Vitamin B6 metabolism (5)
- leucine and isoleucine biosynthesis (5)
- One carbon pool by folate (4)
- Other glycan degradation (4)
- Pantothenate and CoA biosynthesis (4)
- Primary bile acid biosynthesis (4)
- alpha-Linolenic acid metabolism (4)
- Aminoacyl-tRNA biosynthesis (3)
- Caffeine metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Glycosphingolipid biosynthesis - globo series (3)
- O-Glycan biosynthesis (3)
- D-Glutamine and D-glutamate metabolism (2)
- Heparan sulfate biosynthesis (2)
- Phenylalanine (2)
- Steroid biosynthesis (2)
- Thiamine metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- D-Arginine and D-ornithine metabolism (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- RNA polymerase (1)
- Sulfur metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)