LF2 (NC_007605) Virus Tagged ORF Clone
CAT#: VC101168
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401708
View other clones from "Virus" (71)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | LF2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101168 represents NCBI reference of YP_401708 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGAGGCCTACCCCGGTGGTGCTCACGCAGCGCTCGCATCCCGCAGAAGCTCATTCCGGAACTCTT TGCGGAGGCTTAGACCAACCGAGAAACCTGATACGTCCTTCATGAGAGGCGTGTGGAAGTATGAAATCTT TCCTAGTTATGTCAGAGTTACGAACAAGCAGGTGCTCCAGCTCGACGCTCAGTGTCAAGAACTCCCACCA TGTCCTTCCGTGGGGCAAATCTTGAGCTTTAAGCTGCCAAGCTTCAGTTTCAATACAACCACCTACGGGT CCCGGTATTTTACCGTCGCATTCCTCTTTTTTGGAGCCGAGGACAATGAGGTATTCCTGAAGCCATTCTT CGTCATGCACTCAGACCAGGACATCGTGCTTTCCGTGCTGAACCCTCGCTCCCTGTTCATCGAAAAAGGC AAGTTCACGTGGTATATCGTCCCAATAAGGCTCGTGAAGAATCCCTATCTGTATCTGCAGATTCTTCCTG GTCAATCAGACATACAGCTCACCAGGAGTTGTACTCAGAGTGGCGATAAGCTGAATACGTCAGAACCTCA GATATTTCTGAGCGGGTCCCCCGTCACCTCACAGGATGAGTGTCTTCCCTATCTGCTTGCCCAACACACA CCCCCTTTTTTGAAATCCTACGCCCGGATTCACACCTTTCCTGGGAAGGTATGTCCCGTGAACGCAATCC GGAGGGGAAAGGGATACGTGCGCGTGTCTGTCGATACACCTGACCTGAAAAGAGAAGGCCCACTGAACGT CAAGGTTGGTATGACTTTGCTTGACGACGTCATCATAGCGTTTCGGTATAACCCCTACCCTAAGAGCCAT TGGAGATGGGACGGGGAATCCACAGATATCCGCTACTTCGGGTCTCCCGTAATCATACCGCCAAACTTTA TCACCGAGCTGGAATACAACAACACCTACGAAGCTCCGCTGTCATCCAAGATCACTGCCGTGGTTGTCTC CCATTCTTCAAACCCCGTGTTCTATGTCTATCCTCAGGAGTGGAAACCTGGGCAGACACTGAAACTGACC GTTAGGAACATTTCCAACAATCCCATCACAATTGTGACCGGACAATCTATGGCCCAGGCTTTTTTCATCT ACGCGGGCGACCCTAGCATTTCAACCATCATGAGACGGTACATCCAACGGCAGGGGTGTGCGCTGACACT GCCTGGGAATATCGTGGTGGAGAGCTCCAGTCTCCCTACCTTCGAAAGAATAAACAAGACTTTTAACGGC AACATTGTGGCGTCAGAAGGTACACTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101168 representing YP_401708
Red=Cloning sites Green=Tags MAEAYPGGAHAALASRRSSFRNSLRRLRPTEKPDTSFMRGVWKYEIFPSYVRVTNKQVLQLDAQCQELPP CPSVGQILSFKLPSFSFNTTTYGSRYFTVAFLFFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLFIEKG KFTWYIVPIRLVKNPYLYLQILPGQSDIQLTRSCTQSGDKLNTSEPQIFLSGSPVTSQDECLPYLLAQHT PPFLKSYARIHTFPGKVCPVNAIRRGKGYVRVSVDTPDLKREGPLNVKVGMTLLDDVIIAFRYNPYPKSH WRWDGESTDIRYFGSPVIIPPNFITELEYNNTYEAPLSSKITAVVVSHSSNPVFYVYPQEWKPGQTLKLT VRNISNNPITIVTGQSMAQAFFIYAGDPSISTIMRRYIQRQGCALTLPGNIVVESSSLPTFERINKTFNG NIVASEGTL TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_007605 |
ORF Size | 1287 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_007605.1, YP_401708 |
RefSeq ORF | 1287 |
Locus ID | 3783748 |
MW | 48.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101093 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4], codon optimized for human cell expression, YP_401631 |
USD 640.00 |
|
VC101094 | Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4], codon optimized for human cell expression, YP_401632 |
USD 470.00 |
|
VC101095 | Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401633 |
USD 2,100.00 |
|
VC101096 | Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401634 |
USD 400.00 |
|
VC101108 | Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401646 |
USD 400.00 |
|
VC101109 | Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401647 |
USD 400.00 |
|
VC101110 | Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401648 |
USD 670.00 |
|
VC101111 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401649 |
USD 420.00 |
|
VC101112 | Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401650 |
USD 750.00 |
|
VC101116 | Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401654 |
USD 460.00 |
|
VC101117 | Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401655 |
USD 1,320.00 |
|
VC101118 | Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401656 |
USD 400.00 |
|
VC101119 | Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401657 |
USD 500.00 |
|
VC101120 | Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401658 |
USD 450.00 |
|
VC101121 | Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401659 |
USD 610.00 |
|
VC101122 | Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401662 |
USD 1,390.00 |
|
VC101123 | Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401663 |
USD 400.00 |
|
VC101124 | Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401664 |
USD 400.00 |
|
VC101125 | Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401665 |
USD 400.00 |
|
VC101126 | Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401666 |
USD 400.00 |
|
VC101128 | Myc-DDK-tagged ORF clone of viral ORF for BLLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401668 |
USD 400.00 |
|
VC101132 | Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401672 |
USD 400.00 |
|
VC101133 | Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401673 |
USD 400.00 |
|
VC101134 | Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401674 |
USD 770.00 |
|
VC101135 | Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401675 |
USD 400.00 |
|
VC101136 | Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401676 |
USD 680.00 |
|
VC101138 | Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401678 |
USD 400.00 |
|
VC101139 | Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401679 |
USD 400.00 |
|
VC101140 | Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401680 |
USD 400.00 |
|
VC101141 | Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401681 |
USD 1,290.00 |
|
VC101142 | Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401682 |
USD 780.00 |
|
VC101143 | Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401683 |
USD 400.00 |
|
VC101144 | Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401684 |
USD 1,120.00 |
|
VC101145 | Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401685 |
USD 520.00 |
|
VC101146 | Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401686 |
USD 400.00 |
|
VC101147 | Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401687 |
USD 600.00 |
|
VC101148 | Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401688 |
USD 550.00 |
|
VC101149 | Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401689 |
USD 400.00 |
|
VC101150 | Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401690 |
USD 1,100.00 |
|
VC101151 | Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401691 |
USD 420.00 |
|
VC101152 | Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401692 |
USD 650.00 |
|
VC101153 | Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401693 |
USD 400.00 |
|
VC101154 | Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401694 |
USD 400.00 |
|
VC101155 | Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401695 |
USD 540.00 |
|
VC101156 | Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401696 |
USD 400.00 |
|
VC101157 | Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401697 |
USD 2,190.00 |
|
VC101158 | Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401698 |
USD 1,190.00 |
|
VC101159 | Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401699 |
USD 500.00 |
|
VC101160 | Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401700 |
USD 1,120.00 |
|
VC101161 | Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401701 |
USD 770.00 |
|
VC101162 | Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401702 |
USD 400.00 |
|
VC101163 | Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401703 |
USD 720.00 |
|
VC101164 | Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401704 |
USD 770.00 |
|
VC101165 | Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401705 |
USD 430.00 |
|
VC101166 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein [Human herpesvirus 4], codon optimized for human cell expression, YP_401706 |
USD 400.00 |
|
VC101169 | Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401709 |
USD 600.00 |
|
VC101170 | Myc-DDK-tagged ORF clone of viral ORF for RPMS1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401710 |
USD 400.00 |
|
VC101171 | Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401711 |
USD 400.00 |
|
VC101172 | Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401712 |
USD 1,620.00 |
|
VC101173 | Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401713 |
USD 1,370.00 |
|
VC101174 | Myc-DDK-tagged ORF clone of viral ORF for A73 [Human herpesvirus 4], codon optimized for human cell expression, YP_401714 |
USD 400.00 |
|
VC101175 | Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401715 |
USD 1,090.00 |
|
VC101177 | Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401717 |
USD 1,790.00 |
|
VC101178 | Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401718 |
USD 400.00 |
|
VC101179 | Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401719 |
USD 400.00 |
|
VC101180 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4], codon optimized for human cell expression, YP_401720 |
USD 400.00 |
|
VC101181 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4], codon optimized for human cell expression, YP_401721 |
USD 400.00 |
|
VC101183 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4], codon optimized for human cell expression, YP_401728 |
USD 400.00 |
|
VC101184 | Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401724 |
USD 400.00 |
|
VC101185 | Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725 |
USD 400.00 |
|
VC101186 | Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401726 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review