Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRDX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Active filters
Reactivities
- Rat
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- ACTB (3)
- PPARGC1A (3)
- RAC1 (3)
- ABCG2 (2)
- ADH5 (2)
- AOX1 (2)
- BAG3 (2)
- BAX (2)
- BDNF (2)
- BRAF (2)
- CCNA2 (2)
- CHMP4C (2)
- DDX58 (2)
- GAD1 (2)
- GAPDH (2)
- GRIN2B (2)
- HMOX1 (2)
- IRS1 (2)
- KDR (2)
- MAP3K5 (2)
- MAPK8 (2)
- MTNR1A (2)
- MYC (2)
- RELA (2)
- SERPINA3 (2)
- SIGMAR1 (2)
- SLC44A1 (2)
- STAT5A (2)
- VCL (2)
- ABCC4 (1)
- ABCC5 (1)
- ABCD2 (1)
- ACAN (1)
- ACTA2 (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMDEC1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGPAT2 (1)
- AHCY (1)
- AKAP12 (1)
- ANGPTL8 (1)
- ANTXR1 (1)
- AP1M1 (1)
- APOBEC3B (1)
- APP (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- ATXN1 (1)
- AURKB (1)
- BID (1)
- BRCA2 (1)
- BTG3 (1)
- CALN1 (1)
- CAMP (1)
- CANX (1)
- CASP8 (1)
- CASP9 (1)
- CAV1 (1)
- CCKBR (1)
- CCND2 (1)
- CCNE1 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CD44 (1)
- CDH2 (1)
- CDK6 (1)
- CDKN1A (1)
- CDKN2B (1)
- CEBPA (1)
- CELSR1 (1)
- CHRM1 (1)
- CHRM3 (1)
- COL1A1 (1)
- COL2A1 (1)
- CRK (1)
- CS (1)
- CSTB (1)
- CTNNB1 (1)
- CUX1 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- DACT2 (1)
- DCN (1)
- DDR1 (1)
- DIABLO (1)
- DUSP1 (1)
- ENO2 (1)
- EXT1 (1)
- FADD (1)
- FAIM2 (1)
- FAP (1)
- FBXO17 (1)
Applications
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (244)
- Transmembrane (107)
- Transcription Factors (46)
- ES Cell Differentiation/IPS (37)
- Secreted Protein (34)
- Protein Kinase (33)
- GPCR (13)
- Protease (12)
- Stem cell - Pluripotency (11)
- Adult stem cells (9)
- Embryonic stem cells (9)
- Induced pluripotent stem cells (7)
- Cancer stem cells (4)
- Ion Channels: Transient receptor potential (4)
- Nuclear Hormone Receptor (4)
- Stem cell relevant signaling - DSL/Notch pathway (4)
- Stem cell relevant signaling - JAK/STAT signaling pathway (4)
- Ion Channels: Glutamate Receptors (2)
- P450 (2)
- Phosphatase (2)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Other (1)
- Ion Channels: Potassium (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Pathways in cancer (51)
- Focal adhesion (38)
- MAPK signaling pathway (30)
- Metabolic pathways (29)
- Regulation of actin cytoskeleton (27)
- Neurotrophin signaling pathway (24)
- Chemokine signaling pathway (22)
- Pancreatic cancer (22)
- Colorectal cancer (20)
- Toll-like receptor signaling pathway (20)
- Leukocyte transendothelial migration (17)
- Adherens junction (16)
- Chronic myeloid leukemia (16)
- Insulin signaling pathway (16)
- Alzheimer's disease (15)
- Apoptosis (15)
- ErbB signaling pathway (15)
- Huntington's disease (15)
- Natural killer cell mediated cytotoxicity (15)
- Prostate cancer (15)
- Renal cell carcinoma (15)
- Adipocytokine signaling pathway (14)
- Axon guidance (14)
- RIG-I-like receptor signaling pathway (14)
- Small cell lung cancer (14)
- Wnt signaling pathway (14)
- Acute myeloid leukemia (13)
- Cytokine-cytokine receptor interaction (13)
- ECM-receptor interaction (13)
- Neuroactive ligand-receptor interaction (13)
- Amyotrophic lateral sclerosis (ALS) (12)
- Jak-STAT signaling pathway (12)
- NOD-like receptor signaling pathway (12)
- Viral myocarditis (12)
- B cell receptor signaling pathway (11)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Fc gamma R-mediated phagocytosis (11)
- Progesterone-mediated oocyte maturation (11)
- T cell receptor signaling pathway (11)
- VEGF signaling pathway (11)
- Endocytosis (10)
- Fc epsilon RI signaling pathway (10)
- Vascular smooth muscle contraction (10)
- p53 signaling pathway (10)
- Calcium signaling pathway (9)
- Cell cycle (9)
- Cytosolic DNA-sensing pathway (9)
- Pathogenic Escherichia coli infection (9)
- TGF-beta signaling pathway (9)
- Cell adhesion molecules (CAMs) (8)
- Dilated cardiomyopathy (8)
- Glioma (8)
- Type II diabetes mellitus (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Bladder cancer (7)
- Endometrial cancer (7)
- Glycolysis / Gluconeogenesis (7)
- Hematopoietic cell lineage (7)
- Hypertrophic cardiomyopathy (HCM) (7)
- Melanoma (7)
- Tight junction (7)
- mTOR signaling pathway (7)
- Drug metabolism - cytochrome P450 (6)
- GnRH signaling pathway (6)
- Long-term depression (6)
- Long-term potentiation (6)
- Non-small cell lung cancer (6)
- Type I diabetes mellitus (6)
- ABC transporters (5)
- Gap junction (5)
- Parkinson's disease (5)
- Prion diseases (5)
- Thyroid cancer (5)
- Antigen processing and presentation (4)
- Lysosome (4)
- Melanogenesis (4)
- Metabolism of xenobiotics by cytochrome P450 (4)
- Oocyte meiosis (4)
- Porphyrin and chlorophyll metabolism (4)
- Retinol metabolism (4)
- Tyrosine metabolism (4)
- Allograft rejection (3)
- Arginine and proline metabolism (3)
- Citrate cycle (TCA cycle) (3)
- Graft-versus-host disease (3)
- Homologous recombination (3)
- SNARE interactions in vesicular transport (3)
- Valine (3)
- Vibrio cholerae infection (3)
- leucine and isoleucine degradation (3)
- Alanine (2)
- Androgen and estrogen metabolism (2)
- Autoimmune thyroid disease (2)
- Basal cell carcinoma (2)
- Base excision repair (2)
- Butanoate metabolism (2)
- Cardiac muscle contraction (2)
- Complement and coagulation cascades (2)
- DNA replication (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - other enzymes (2)
- Fatty acid metabolism (2)
- Fructose and mannose metabolism (2)
- Glycerophospholipid metabolism (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Oxidative phosphorylation (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Sphingolipid metabolism (2)
- Systemic lupus erythematosus (2)
- Taurine and hypotaurine metabolism (2)
- Tryptophan metabolism (2)
- Vitamin B6 metabolism (2)
- aspartate and glutamate metabolism (2)
- beta-Alanine metabolism (2)
- Ascorbate and aldarate metabolism (1)
- Asthma (1)
- Cysteine and methionine metabolism (1)
- Ether lipid metabolism (1)
- Folate biosynthesis (1)
- Galactose metabolism (1)
- Glycerolipid metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Heparan sulfate biosynthesis (1)
- Inositol phosphate metabolism (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- PPAR signaling pathway (1)
- Pentose and glucuronate interconversions (1)
- Pentose phosphate pathway (1)
- Phosphatidylinositol signaling system (1)
- Primary immunodeficiency (1)
- Propanoate metabolism (1)
- RNA degradation (1)
- Ribosome (1)
- Selenoamino acid metabolism (1)
- Starch and sucrose metabolism (1)