B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
USD 320.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Goat, Human, Porcine, Primate |
USD 745.00
5 Days
Complement C4A (C4A) (neoepitope) mouse monoclonal antibody, clone 057-51.5.1.6, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
USD 515.00
In Stock
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
C1QA goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization. |
CD59 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD59 |
Rabbit anti-CFB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFB |
Complement C3 (C3) goat polyclonal antibody, FITC
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | C3c is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization. |
Rabbit Polyclonal Anti-SERPINC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
Rabbit Polyclonal Anti-FGA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the N terminal of human FGA. Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS |
Complement C3 (C3) mouse monoclonal antibody, clone 10-02A, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Complement C3 (C3) mouse monoclonal antibody, clone H11, Purified
| Applications | IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal antibody to C1 inhibitor (serpin peptidase inhibitor, clade G (C1 inhibitor), member 1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 77 and 420 of C1 inhibitor (Uniprot ID#P05155) |
USD 590.00
5 Days
Complement factor B (CFB) (Ba Fragment) mouse monoclonal antibody, clone 014III-33.2.4.3, Purified
| Applications | ELISA, FC, FN, IHC, WB |
| Reactivities | Human |
Complement C3 (C3) goat polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | C3c is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization. |
Complement C3 (C3) goat polyclonal antibody, HRP
| Applications | ELISA, ID, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | C3c is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization. |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, Purified
| Applications | ELISA, FC, IHC, IP, R, WB |
| Reactivities | Human |
Complement C4A (C4A) mouse monoclonal antibody, clone 10-12, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
USD 590.00
5 Days
Complement factor B (CFB) (Bb Fragment) mouse monoclonal antibody, clone 10-09, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
USD 745.00
5 Days
Complement C3 (C3) (Neoantigen, iC3b) mouse monoclonal antibody, clone 013III-1.16, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Factor H (CFH) mouse monoclonal antibody, clone OX-24, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Complement C3 (C3) goat polyclonal antibody, TRITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | TRITC |
| Immunogen | C3c is isolated and purified from pooled normal human serum. Freund’s complete adjuvant is used in the first step of the immunization. |
Complement C5 (C5) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | C5 protein isolated and purified from pooled normal human serum. Freund’s complete adjuvant is used in the first step of the immunization |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Factor VIII Sheep Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | F8 / FVIII / Factor VIII antibody was raised against human Factor VIIIC (F. VIII) purified from F. VIII concentrate. |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Germany
Japan
United Kingdom
China
