Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRDX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Reactivities
- Rat
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- AOX1 (2)
- BAG3 (2)
- BAX (2)
- GAD1 (2)
- RELA (2)
- SERPINA3 (2)
- ABCC4 (1)
- ABCC5 (1)
- ABCG2 (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAMDEC1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- ADH5 (1)
- AKAP12 (1)
- ANGPTL8 (1)
- ANTXR1 (1)
- AP1M1 (1)
- APOBEC3B (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- ATXN1 (1)
- BID (1)
- BRCA2 (1)
- BTG3 (1)
- CALN1 (1)
- CAV1 (1)
- CCND2 (1)
- CCNE1 (1)
- CD274 (1)
- CD276 (1)
- CDK6 (1)
- CDKN2B (1)
- CEBPA (1)
- COL1A1 (1)
- COL2A1 (1)
- CS (1)
- CSTB (1)
- CTNNB1 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- DACT2 (1)
- DCN (1)
- DDR1 (1)
- DDX58 (1)
- DIABLO (1)
- FAIM2 (1)
- FOXO1 (1)
- FOXP3 (1)
- FRMPD2 (1)
- FTH1 (1)
- GAB2 (1)
- GAS6 (1)
- GCH1 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- GZMB (1)
- HAP1 (1)
- HIF1A (1)
- HMMR (1)
- HMOX1 (1)
- HOXC8 (1)
- HSP90AA1 (1)
- IGF1R (1)
- IL18 (1)
- IL1R1 (1)
- IMMT (1)
- IRF3 (1)
- IRF7 (1)
- IRS1 (1)
- ITGAX (1)
- ITGB6 (1)
- JAK1 (1)
- JMJD6 (1)
- KDR (1)
- KLK5 (1)
- KLK7 (1)
- KRT19 (1)
- LAMA1 (1)
- LAMP1 (1)
- LIF (1)
- LTBR (1)
- MAP1LC3B (1)
- MPC1 (1)
- MSH6 (1)
- MTNR1A (1)
- MTOR (1)
- MYC (1)
- MYCN (1)
- MYH3 (1)
- MYL2 (1)
- NFKB1 (1)
- NGF (1)
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (128)
- Transmembrane (53)
- Transcription Factors (26)
- Secreted Protein (23)
- Protein Kinase (13)
- ES Cell Differentiation/IPS (12)
- GPCR (7)
- Protease (6)
- Stem cell - Pluripotency (5)
- Adult stem cells (3)
- Cancer stem cells (2)
- Embryonic stem cells (2)
- Induced pluripotent stem cells (2)
- Nuclear Hormone Receptor (2)
- P450 (2)
- Ion Channels: Other (1)
- Ion Channels: Transient receptor potential (1)
- Phosphatase (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
Pathways
- Pathways in cancer (26)
- Focal adhesion (16)
- Metabolic pathways (15)
- Chemokine signaling pathway (10)
- ECM-receptor interaction (10)
- Pancreatic cancer (9)
- Prostate cancer (9)
- Small cell lung cancer (9)
- Toll-like receptor signaling pathway (9)
- Adipocytokine signaling pathway (8)
- Apoptosis (8)
- MAPK signaling pathway (8)
- Neurotrophin signaling pathway (8)
- RIG-I-like receptor signaling pathway (8)
- Cytokine-cytokine receptor interaction (7)
- Cytosolic DNA-sensing pathway (7)
- Huntington's disease (7)
- NOD-like receptor signaling pathway (7)
- Regulation of actin cytoskeleton (7)
- p53 signaling pathway (7)
- Acute myeloid leukemia (6)
- Colorectal cancer (6)
- Jak-STAT signaling pathway (6)
- Chronic myeloid leukemia (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Insulin signaling pathway (5)
- Leukocyte transendothelial migration (5)
- Renal cell carcinoma (5)
- T cell receptor signaling pathway (5)
- Adherens junction (4)
- Alzheimer's disease (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Axon guidance (4)
- B cell receptor signaling pathway (4)
- Cell cycle (4)
- Dilated cardiomyopathy (4)
- Drug metabolism - cytochrome P450 (4)
- Natural killer cell mediated cytotoxicity (4)
- Neuroactive ligand-receptor interaction (4)
- ABC transporters (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Citrate cycle (TCA cycle) (3)
- Endocytosis (3)
- ErbB signaling pathway (3)
- Glioma (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Lysosome (3)
- Oocyte meiosis (3)
- Progesterone-mediated oocyte maturation (3)
- TGF-beta signaling pathway (3)
- Tight junction (3)
- Type I diabetes mellitus (3)
- Type II diabetes mellitus (3)
- Tyrosine metabolism (3)
- Valine (3)
- Vascular smooth muscle contraction (3)
- Viral myocarditis (3)
- Wnt signaling pathway (3)
- leucine and isoleucine degradation (3)
- Alanine (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Butanoate metabolism (2)
- Cardiac muscle contraction (2)
- Complement and coagulation cascades (2)
- Fc epsilon RI signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Gap junction (2)
- GnRH signaling pathway (2)
- Hematopoietic cell lineage (2)
- Homologous recombination (2)
- Melanogenesis (2)
- Melanoma (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Oxidative phosphorylation (2)
- Parkinson's disease (2)
- Pathogenic Escherichia coli infection (2)
- Porphyrin and chlorophyll metabolism (2)
- Prion diseases (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Retinol metabolism (2)
- SNARE interactions in vesicular transport (2)
- Taurine and hypotaurine metabolism (2)
- Tryptophan metabolism (2)
- VEGF signaling pathway (2)
- Vitamin B6 metabolism (2)
- aspartate and glutamate metabolism (2)
- beta-Alanine metabolism (2)
- mTOR signaling pathway (2)
- Allograft rejection (1)
- Androgen and estrogen metabolism (1)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Basal cell carcinoma (1)
- Base excision repair (1)
- DNA replication (1)
- Drug metabolism - other enzymes (1)
- Endometrial cancer (1)
- Fatty acid metabolism (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Graft-versus-host disease (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Methane metabolism (1)
- N-Glycan biosynthesis (1)
- Non-small cell lung cancer (1)
- Propanoate metabolism (1)
- Sphingolipid metabolism (1)
- Thyroid cancer (1)