Germany
Japan
United Kingdom
China
Antibodies
Download
USD 250.00
2 Weeks
USD 420.00
In Stock
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Birds, Mammalian, Yeast |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-WDR5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human JMJD2a (Jumonji domain containing 2a), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
IL6R mouse monoclonal antibody, clone B-R6, Azide Free
| Applications | FC, FN, IHC, IP |
| Reactivities | Human |
DHLAG (CD74) mouse monoclonal antibody, clone LN2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Baboon |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Active filters
Applications
- IP
Families
- Druggable Genome
Filter by
Target Symbol
- LIPG (105)
- BRAF (70)
- MAPK1 (51)
- NEUROG1 (45)
- NRBP1 (45)
- LTA4H (40)
- RPA2 (37)
- GBE1 (35)
- L1CAM (35)
- TYRO3 (35)
- PIM2 (31)
- PLK1 (30)
- SERPINA1 (26)
- CHEK2 (25)
- DAPK2 (25)
- LDHA (20)
- MAP2K4 (20)
- LTF (16)
- GAD1 (15)
- HDAC10 (15)
- NEK6 (15)
- USP13 (15)
- AKT2 (10)
- SLC7A8 (10)
- TUBA8 (10)
- C2 (7)
- CD8A (7)
- MYC (7)
- MDH1 (6)
- SHC1 (6)
- CD74 (5)
- CP (5)
- EGFR (5)
- PLG (5)
- SORD (5)
- TUBA1B (5)
- XRCC5 (5)
- BAX (4)
- C3 (4)
- CD3E (4)
- MAPK8 (4)
- NGFR (4)
- AKT1 (3)
- BCHE (3)
- CA1 (3)
- CFI (3)
- COL5A1 (3)
- CTNNB1 (3)
- EPHB1 (3)
- HSP90AB1 (3)
- HSPD1 (3)
- IL6ST (3)
- LAMA4 (3)
- LGR5 (3)
- MAPRE2 (3)
- PGAM2 (3)
- SERPING1 (3)
- ACPP (2)
- AFP (2)
- BCL2 (2)
- C5 (2)
- CA9 (2)
- CBS (2)
- CD163 (2)
- CD28 (2)
- CD44 (2)
- CDK1 (2)
- CDX2 (2)
- CEACAM1 (2)
- CFH (2)
- CNTNAP2 (2)
- COL1A1 (2)
- CTSD (2)
- CYCLIN H (2)
- DCTN1 (2)
- GUCA2B (2)
- HP1 GAMMA (2)
- ICAM1 (2)
- KCNAB1 (2)
- KCNH2 (2)
- KDM1A (2)
- KNG1 (2)
- MAP2 (2)
- MAPK14 (2)
- NR3C1 (2)
- PPP1CC (2)
- PRKDC (2)
- PRMT4 (2)
- SERPINF2 (2)
- SIRT7 (2)
- SMARCA4 (2)
- TF (2)
- TP53 (2)
- ZAP70 (2)
- ABCA1 (1)
- ABCF1 (1)
- ACTN1 (1)
- AK4 (1)
- AKR1C3 (1)
- APEH (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Metabolic pathways (249)
- Pathways in cancer (225)
- MAPK signaling pathway (189)
- Acute myeloid leukemia (182)
- ErbB signaling pathway (181)
- Progesterone-mediated oocyte maturation (178)
- Focal adhesion (172)
- Colorectal cancer (167)
- Neurotrophin signaling pathway (165)
- Bladder cancer (164)
- Chronic myeloid leukemia (162)
- Prostate cancer (160)
- Insulin signaling pathway (155)
- Pancreatic cancer (155)
- Endometrial cancer (154)
- Glioma (153)
- Chemokine signaling pathway (148)
- Melanoma (146)
- Non-small cell lung cancer (146)
- Regulation of actin cytoskeleton (143)
- Natural killer cell mediated cytotoxicity (140)
- mTOR signaling pathway (139)
- Renal cell carcinoma (138)
- Thyroid cancer (136)
- Long-term potentiation (126)
- Vascular smooth muscle contraction (126)
- Long-term depression (124)
- Glycerolipid metabolism (105)
- Toll-like receptor signaling pathway (102)
- Fc epsilon RI signaling pathway (93)
- Axon guidance (91)
- Oocyte meiosis (91)
- T cell receptor signaling pathway (91)
- Cell cycle (87)
- GnRH signaling pathway (84)
- Gap junction (79)
- B cell receptor signaling pathway (72)
- Fc gamma R-mediated phagocytosis (70)
- Adherens junction (69)
- TGF-beta signaling pathway (68)
- VEGF signaling pathway (67)
- NOD-like receptor signaling pathway (66)
- Complement and coagulation cascades (63)
- Prion diseases (60)
- Type II diabetes mellitus (59)
- Melanogenesis (58)
- Alzheimer's disease (56)
- Cell adhesion molecules (CAMs) (56)
- Dorso-ventral axis formation (56)
- Nucleotide excision repair (46)
- Arachidonic acid metabolism (41)
- DNA replication (41)
- Homologous recombination (39)
- Mismatch repair (39)
- Small cell lung cancer (39)
- p53 signaling pathway (37)
- Starch and sucrose metabolism (36)
- Epithelial cell signaling in Helicobacter pylori infection (35)
- Apoptosis (33)
- Jak-STAT signaling pathway (30)
- Pyruvate metabolism (30)
- Glycolysis / Gluconeogenesis (29)
- Pathogenic Escherichia coli infection (28)
- Tight junction (28)
- Adipocytokine signaling pathway (27)
- Cytokine-cytokine receptor interaction (25)
- Cysteine and methionine metabolism (23)
- Wnt signaling pathway (23)
- Hematopoietic cell lineage (21)
- Propanoate metabolism (21)
- Systemic lupus erythematosus (20)
- Type I diabetes mellitus (20)
- Leukocyte transendothelial migration (18)
- Butanoate metabolism (17)
- Huntington's disease (17)
- Alanine (16)
- Antigen processing and presentation (16)
- aspartate and glutamate metabolism (16)
- beta-Alanine metabolism (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (15)
- Hypertrophic cardiomyopathy (HCM) (15)
- Primary immunodeficiency (15)
- Taurine and hypotaurine metabolism (15)
- Amyotrophic lateral sclerosis (ALS) (14)
- Viral myocarditis (14)
- Dilated cardiomyopathy (13)
- ECM-receptor interaction (13)
- Endocytosis (12)
- RIG-I-like receptor signaling pathway (12)
- Non-homologous end-joining (10)
- Citrate cycle (TCA cycle) (9)
- Neuroactive ligand-receptor interaction (9)
- Calcium signaling pathway (8)
- Vibrio cholerae infection (7)
- Basal cell carcinoma (6)
- Fructose and mannose metabolism (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Porphyrin and chlorophyll metabolism (6)
- Cytosolic DNA-sensing pathway (5)
- Nitrogen metabolism (5)
- Purine metabolism (5)
- Ubiquitin mediated proteolysis (5)
- Notch signaling pathway (4)
- PPAR signaling pathway (4)
- Proteasome (4)
- Pyrimidine metabolism (4)
- RNA degradation (4)
- Allograft rejection (3)
- Autoimmune thyroid disease (3)
- Glycine (3)
- Graft-versus-host disease (3)
- Selenoamino acid metabolism (3)
- serine and threonine metabolism (3)
- Cardiac muscle contraction (2)
- Fatty acid metabolism (2)
- Histidine metabolism (2)
- Lysine degradation (2)
- Lysosome (2)
- Parkinson's disease (2)
- Riboflavin metabolism (2)
- Taste transduction (2)
- Valine (2)
- ABC transporters (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Arginine and proline metabolism (1)
- Asthma (1)
- Basal transcription factors (1)
- Base excision repair (1)
- Biosynthesis of unsaturated fatty acids (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Folate biosynthesis (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Hedgehog signaling pathway (1)
- Limonene and pinene degradation (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Methane metabolism (1)
- Phenylalanine metabolism (1)
- RNA polymerase (1)
- Regulation of autophagy (1)
- SNARE interactions in vesicular transport (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)