pVI (AC_000019) Virus Tagged ORF Clone
CAT#: VC100086
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 35], codon optimized for human cell expression, AP_000584
View other clones from "Virus" (36)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | pVI |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100086 represents NCBI reference of AP_000584 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGGATATCAATTTTAGCTCCCTGGCTCCCAGACATGGGACCAAACCCTATATGGGCACATGGAGTG ACATTGGCACCTCACAACTGAATGGCGGAGCTTTCAACTGGAGCAGTATTTGGTCTGGCCTCAAAAATTT TGGTAGCACCATCAAGACTTATGGCAATAAAGCTTGGAACAGTTCCACCGGTCAGGCCCTTAGGAATAAG CTTAAGGACCAGAATTTCCAGCAGAAAGTAGTCGATGGCATCGCTAGTGGAATTAATGGGGTTGTTGATC TGGCCAACCAAGCAGTGCAGAAAAAGATTAATAGTAGGTTGGATCCTCCACCAGCTACCCCCGGCGAGAT GCAGGTGGAAGAGGAGATACCTCCCCCCGAAAAAAGAGGGGACAAGAGACCCCGGCCAGACCTTGAAGAG ACACTGGTGACGAGGGTGGACGAGCCCCCCTCCTACGAAGAAGCCACTAAACTTGGTATGCCCACTACCC GACCTATAGCCCCAATGGCCACAGGAGTTATGAAACCCTCTCAACTGCATAGACCAGTGACTCTCGATCT GCCTCCCCCGCCAGCTGCCACGGCCGTGCCAGCGTCTAAACCAGTTGCAGCACCTAAGCCAGTGGCAGTA GCAAGGAGTAGGCCAGGTGGAGCCCCTCGGCCGAACGCACACTGGCAGAACACACTGAACAGTATTGTGG GCCTCGGAGTGCAGTCTGTGAAGAGAAGAAGATGCTTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100086 representing AP_000584
Red=Cloning sites Green=Tags MEDINFSSLAPRHGTKPYMGTWSDIGTSQLNGGAFNWSSIWSGLKNFGSTIKTYGNKAWNSSTGQALRNK LKDQNFQQKVVDGIASGINGVVDLANQAVQKKINSRLDPPPATPGEMQVEEEIPPPEKRGDKRPRPDLEE TLVTRVDEPPSYEEATKLGMPTTRPIAPMATGVMKPSQLHRPVTLDLPPPPAATAVPASKPVAAPKPVAV ARSRPGGAPRPNAHWQNTLNSIVGLGVQSVKRRRCF TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | AC_000019 |
ORF Size | 738 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | AC_000019.1, AP_000584 |
RefSeq ORF | 738 |
MW | 26.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100073 | Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 35], codon optimized for human cell expression, AP_000571 |
USD 400.00 |
|
VC100074 | Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 35], codon optimized for human cell expression, AP_000572 |
USD 400.00 |
|
VC100075 | Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 35], codon optimized for human cell expression, AP_000573 |
USD 630.00 |
|
VC100076 | Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 35], codon optimized for human cell expression, AP_000574 |
USD 400.00 |
|
VC100077 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 35], codon optimized for human cell expression, AP_000575 |
USD 580.00 |
|
VC100078 | Myc-DDK-tagged ORF clone of viral ORF for pol [Human adenovirus 35], codon optimized for human cell expression, AP_000576 |
USD 1,900.00 |
|
VC100079 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 35], codon optimized for human cell expression, AP_000577 |
USD 830.00 |
|
VC100080 | Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 35], codon optimized for human cell expression, AP_000578 |
USD 490.00 |
|
VC100081 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 35], codon optimized for human cell expression, AP_000579 |
USD 740.00 |
|
VC100082 | Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 35], codon optimized for human cell expression, AP_000580 |
USD 710.00 |
|
VC100083 | Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 35], codon optimized for human cell expression, AP_000581 |
USD 400.00 |
|
VC100084 | Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 35], codon optimized for human cell expression, AP_000582 |
USD 440.00 |
|
VC100085 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 35], codon optimized for human cell expression, AP_000583 |
USD 400.00 |
|
VC100087 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 35], codon optimized for human cell expression, AP_000585 |
USD 1,510.00 |
|
VC100088 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 35], codon optimized for human cell expression, AP_000586 |
USD 400.00 |
|
VC100089 | Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 35], codon optimized for human cell expression, AP_000587 |
USD 660.00 |
|
VC100090 | Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 35], codon optimized for human cell expression, AP_000588 |
USD 1,300.00 |
|
VC100091 | Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 35], codon optimized for human cell expression, AP_000589 |
USD 400.00 |
|
VC100092 | Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 35], codon optimized for human cell expression, AP_000590 |
USD 400.00 |
|
VC100093 | Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 35], codon optimized for human cell expression, AP_000591 |
USD 400.00 |
|
VC100094 | Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 35], codon optimized for human cell expression, AP_000592 |
USD 400.00 |
|
VC100095 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha0 [Human adenovirus 35], codon optimized for human cell expression, AP_000593 |
USD 400.00 |
|
VC100096 | Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 35], codon optimized for human cell expression, AP_000594 |
USD 400.00 |
|
VC100097 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-beta1 [Human adenovirus 35], codon optimized for human cell expression, AP_000595 |
USD 400.00 |
|
VC100098 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-gamma1 [Human adenovirus 35], codon optimized for human cell expression, AP_000596 |
USD 400.00 |
|
VC100099 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 35], codon optimized for human cell expression, AP_000597 |
USD 400.00 |
|
VC100100 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus 35], codon optimized for human cell expression, AP_000598 |
USD 400.00 |
|
VC100101 | Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 35], codon optimized for human cell expression, AP_000599 |
USD 400.00 |
|
VC100102 | Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 35], codon optimized for human cell expression, AP_000600 |
USD 400.00 |
|
VC100103 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 35], codon optimized for human cell expression, AP_000601 |
USD 400.00 |
|
VC100104 | Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 35], codon optimized for human cell expression, AP_000603 |
USD 400.00 |
|
VC100105 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 35], codon optimized for human cell expression, AP_000602 |
USD 400.00 |
|
VC100106 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 35], codon optimized for human cell expression, AP_000604 |
USD 400.00 |
|
VC100107 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 35], codon optimized for human cell expression, AP_000605 |
USD 400.00 |
|
VC100108 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF2 [Human adenovirus 35], codon optimized for human cell expression, AP_000606 |
USD 400.00 |
|
VC100109 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 35], codon optimized for human cell expression, AP_000607 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review