Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (42)
- EGFR (30)
- RELA (26)
- MAPT (25)
- JUN (21)
- SMAD1 (21)
- EZR (18)
- IRS1 (18)
- RPS6KB1 (18)
- CDC25A (17)
- CREB1 (17)
- MAPK14 (17)
- STAT3 (17)
- ATF2 (16)
- CTNNB1 (16)
- ESR1 (16)
- KDR (16)
- NR3C1 (16)
- SMAD3 (16)
- STAT1 (16)
- APP (15)
- NFKBIA (15)
- SMAD2 (15)
- FOXO1 (14)
- HDAC2 (14)
- HDAC5 (14)
- LCK (14)
- PRKCD (14)
- RAF1 (14)
- TP53 (14)
- BRAF (13)
- ERBB2 (13)
- GSK3B (13)
- HSP90AB1 (13)
- IGF1R (13)
- MAP2K1 (13)
- CCNB1 (12)
- DOK1 (12)
- HDAC1 (12)
- MET (12)
- MYC (12)
- PTPN11 (12)
- SRC (12)
- ABL1 (11)
- BCL2L1 (11)
- CHEK2 (11)
- CHUK (11)
- CSF1R (11)
- FGFR1 (11)
- JAK2 (11)
- MAPK1 (11)
- MAPK8 (11)
- NOS3 (11)
- PAK1 (11)
- PRKCA (11)
- PTEN (11)
- PTK2 (11)
- PXN (11)
- RB1 (11)
- ROCK2 (11)
- RUNX1 (11)
- SNCA (11)
- STAT5A (11)
- BAD (10)
- BCL2 (10)
- CASP3 (10)
- CASP9 (10)
- CDK1 (10)
- CDK2 (10)
- DNM1 (10)
- GRIN2B (10)
- HSPD1 (10)
- LOX (10)
- MAP3K7 (10)
- NGFR (10)
- VASP (10)
- BAX (9)
- BCL2L11 (9)
- CTTN (9)
- FOS (9)
- GSK3A (9)
- HDAC6 (9)
- HSPA5 (9)
- ITGB3 (9)
- MAPK3 (9)
- PDCD4 (9)
- PLCG1 (9)
- RAB5A (9)
- RPS6KA1 (9)
- SHC1 (9)
- STAT5B (9)
- SYK (9)
- TH (9)
- UCHL1 (9)
- AIFM1 (8)
- AKT2 (8)
- BECN1 (8)
- CALR (8)
- CANX (8)
- CASP6 (8)
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (1246)
- MAPK signaling pathway (775)
- Focal adhesion (675)
- Neurotrophin signaling pathway (602)
- Metabolic pathways (594)
- Prostate cancer (542)
- Chemokine signaling pathway (537)
- ErbB signaling pathway (496)
- Chronic myeloid leukemia (483)
- Colorectal cancer (477)
- Pancreatic cancer (472)
- Regulation of actin cytoskeleton (466)
- T cell receptor signaling pathway (451)
- Insulin signaling pathway (431)
- Cell cycle (423)
- Cytokine-cytokine receptor interaction (405)
- Toll-like receptor signaling pathway (395)
- Small cell lung cancer (372)
- Wnt signaling pathway (370)
- Neuroactive ligand-receptor interaction (369)
- Apoptosis (359)
- Acute myeloid leukemia (356)
- Glioma (352)
- B cell receptor signaling pathway (347)
- Progesterone-mediated oocyte maturation (344)
- Jak-STAT signaling pathway (343)
- Melanoma (343)
- Endometrial cancer (328)
- Non-small cell lung cancer (328)
- Leukocyte transendothelial migration (323)
- Fc gamma R-mediated phagocytosis (321)
- VEGF signaling pathway (319)
- Adipocytokine signaling pathway (318)
- Adherens junction (315)
- Calcium signaling pathway (308)
- Natural killer cell mediated cytotoxicity (307)
- Renal cell carcinoma (306)
- GnRH signaling pathway (299)
- Fc epsilon RI signaling pathway (295)
- Alzheimer's disease (287)
- Endocytosis (284)
- Epithelial cell signaling in Helicobacter pylori infection (280)
- Axon guidance (277)
- Gap junction (259)
- TGF-beta signaling pathway (259)
- Tight junction (254)
- Oocyte meiosis (246)
- Melanogenesis (243)
- Bladder cancer (240)
- p53 signaling pathway (226)
- Vascular smooth muscle contraction (223)
- NOD-like receptor signaling pathway (220)
- Amyotrophic lateral sclerosis (ALS) (218)
- Huntington's disease (212)
- Long-term potentiation (211)
- Long-term depression (199)
- mTOR signaling pathway (192)
- RIG-I-like receptor signaling pathway (177)
- Pathogenic Escherichia coli infection (159)
- Type II diabetes mellitus (154)
- Ubiquitin mediated proteolysis (145)
- Thyroid cancer (133)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (130)
- Hypertrophic cardiomyopathy (HCM) (129)
- Dilated cardiomyopathy (125)
- Hematopoietic cell lineage (118)
- Parkinson's disease (108)
- Prion diseases (106)
- Basal cell carcinoma (104)
- Cell adhesion molecules (CAMs) (99)
- Cytosolic DNA-sensing pathway (97)
- Viral myocarditis (93)
- Phosphatidylinositol signaling system (92)
- Dorso-ventral axis formation (91)
- Glycolysis / Gluconeogenesis (89)
- Primary immunodeficiency (85)
- Vibrio cholerae infection (85)
- ECM-receptor interaction (83)
- Notch signaling pathway (83)
- Purine metabolism (83)
- Antigen processing and presentation (76)
- Hedgehog signaling pathway (71)
- PPAR signaling pathway (69)
- Base excision repair (64)
- Nucleotide excision repair (64)
- Complement and coagulation cascades (61)
- Arginine and proline metabolism (57)
- Inositol phosphate metabolism (56)
- Lysosome (54)
- Fructose and mannose metabolism (51)
- Pyruvate metabolism (49)
- Tyrosine metabolism (46)
- ABC transporters (44)
- Metabolism of xenobiotics by cytochrome P450 (44)
- Type I diabetes mellitus (44)
- Valine (44)
- Homologous recombination (43)
- Pyrimidine metabolism (42)
- Drug metabolism - cytochrome P450 (41)
- Regulation of autophagy (40)
- Retinol metabolism (40)
- Tryptophan metabolism (39)
- Glycerolipid metabolism (38)
- Proteasome (38)
- Butanoate metabolism (37)
- DNA replication (36)
- Systemic lupus erythematosus (36)
- leucine and isoleucine degradation (36)
- Cardiac muscle contraction (35)
- Maturity onset diabetes of the young (34)
- Olfactory transduction (34)
- Galactose metabolism (32)
- Renin-angiotensin system (32)
- Alanine (31)
- Fatty acid metabolism (31)
- Mismatch repair (31)
- aspartate and glutamate metabolism (31)
- Non-homologous end-joining (29)
- Citrate cycle (TCA cycle) (28)
- Cysteine and methionine metabolism (28)
- Glutathione metabolism (28)
- Arachidonic acid metabolism (27)
- Histidine metabolism (27)
- Propanoate metabolism (27)
- Taste transduction (27)
- Lysine degradation (26)
- Oxidative phosphorylation (26)
- beta-Alanine metabolism (26)
- Drug metabolism - other enzymes (24)
- Pentose phosphate pathway (24)
- SNARE interactions in vesicular transport (23)
- Amino sugar and nucleotide sugar metabolism (22)
- Nitrogen metabolism (22)
- Porphyrin and chlorophyll metabolism (21)
- Androgen and estrogen metabolism (20)
- Autoimmune thyroid disease (20)
- Glycerophospholipid metabolism (20)
- Allograft rejection (19)
- Glycine (19)
- Starch and sucrose metabolism (19)
- serine and threonine metabolism (19)
- Phenylalanine metabolism (18)
- RNA degradation (18)
- Sphingolipid metabolism (18)
- Graft-versus-host disease (17)
- Basal transcription factors (15)
- Pentose and glucuronate interconversions (13)
- Ascorbate and aldarate metabolism (12)
- Primary bile acid biosynthesis (12)
- Taurine and hypotaurine metabolism (12)
- Glycosaminoglycan degradation (11)
- Limonene and pinene degradation (11)
- Linoleic acid metabolism (11)
- Nicotinate and nicotinamide metabolism (11)
- leucine and isoleucine biosynthesis (11)
- Ether lipid metabolism (10)
- Folate biosynthesis (10)
- Ribosome (10)
- Circadian rhythm - mammal (9)
- Selenoamino acid metabolism (9)
- Asthma (8)
- Fatty acid biosynthesis (8)
- Methane metabolism (8)
- Riboflavin metabolism (8)
- Spliceosome (8)
- N-Glycan biosynthesis (7)
- Other glycan degradation (7)
- Steroid biosynthesis (6)
- Biosynthesis of unsaturated fatty acids (5)
- C21-Steroid hormone metabolism (5)
- Glyoxylate and dicarboxylate metabolism (5)
- Pantothenate and CoA biosynthesis (5)
- Terpenoid backbone biosynthesis (5)
- Aminoacyl-tRNA biosynthesis (4)
- One carbon pool by folate (4)
- RNA polymerase (4)
- Vitamin B6 metabolism (4)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Heparan sulfate biosynthesis (3)
- O-Glycan biosynthesis (3)
- alpha-Linolenic acid metabolism (3)
- Caffeine metabolism (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Phenylalanine (2)
- Synthesis and degradation of ketone bodies (2)
- Thiamine metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- D-Arginine and D-ornithine metabolism (1)
- Keratan sulfate biosynthesis (1)
- Sulfur metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)