Germany
Japan
United Kingdom
China
Products
Download
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
USD 340.00
2 Weeks
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Active filters
Applications
- IHC
Pathways
- Cell cycle
Filter by
Target Symbol
- TP53 (149)
- CDKN2A (91)
- PCNA (74)
- BUB1B (52)
- MCM2 (52)
- MDM2 (48)
- CHEK2 (38)
- GADD45G (37)
- MYC (32)
- SMC1A (29)
- PLK1 (27)
- RB1 (27)
- ANAPC11 (25)
- CDKN1A (21)
- HDAC2 (18)
- CDC6 (17)
- CDKN2B (17)
- HDAC1 (13)
- ABL1 (12)
- CCNB1 (12)
- SMAD3 (12)
- RAD21 (10)
- GSK3B (9)
- PRKDC (9)
- CDK1 (8)
- CDK6 (8)
- YWHAB (8)
- CCND1 (7)
- CDC25A (7)
- CDK7 (7)
- EP300 (7)
- PKMYT1 (7)
- ANAPC1 (6)
- ANAPC2 (6)
- CCNE1 (6)
- CDC16 (6)
- CDKN1B (6)
- CHEK1 (6)
- SMAD2 (6)
- TGFB1 (6)
- YWHAQ (6)
- YWHAZ (6)
- ATM (5)
- CCNA1 (5)
- CDC45 (5)
- CREBBP (5)
- MCM6 (5)
- SFN (5)
- CCND3 (4)
- CDC27 (4)
- CDKN1C (4)
- CDKN2C (4)
- CUL1 (4)
- MAD2L1 (4)
- MCM3 (4)
- MCM7 (4)
- PTTG1 (4)
- SMAD4 (4)
- TFDP1 (4)
- TGFB3 (4)
- YWHAE (4)
- YWHAG (4)
- ANAPC10 (3)
- ANAPC4 (3)
- ANAPC5 (3)
- CCNE2 (3)
- CCNH (3)
- CDC20 (3)
- CDC25B (3)
- CDC25C (3)
- CDC7 (3)
- CDK4 (3)
- E2F1 (3)
- E2F4 (3)
- MCM5 (3)
- SKP1 (3)
- SKP2 (3)
- ANAPC7 (2)
- ATR (2)
- BUB1 (2)
- CCNB2 (2)
- CCND2 (2)
- CDK2 (2)
- CDKN2D (2)
- DCLRE1C (2)
- E2F2 (2)
- ESPL1 (2)
- GADD45A (2)
- GADD45B (2)
- RBL2 (2)
- STAG2 (2)
- TFDP2 (2)
- TGFB2 (2)
- YWHAH (2)
- ANAPC13 (1)
- BUB3 (1)
- CCNA2 (1)
- CDC2 (1)
- CDC23 (1)
- DBF4 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1054)
- Stem cell - Pluripotency (511)
- Transcription Factors (448)
- Protein Kinase (202)
- Stem cell relevant signaling - JAK/STAT signaling pathway (57)
- Embryonic stem cells (50)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Stem cell relevant signaling - Wnt Signaling pathway (39)
- Induced pluripotent stem cells (32)
- Stem cell relevant signaling - DSL/Notch pathway (26)
- ES Cell Differentiation/IPS (24)
- Cancer stem cells (18)
- Secreted Protein (17)
- Adult stem cells (13)
- Phosphatase (13)
- Transmembrane (6)
- Protease (2)