E3 RID-alpha (AC_000008) Virus Tagged ORF Clone

CAT#: VC100135

Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 5], codon optimized for human cell expression, AP_000222

Specifications

Product Data

• Type: Virus Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: E3 RID-alpha
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >The Viral ORF clone VC100135 represents NCBI reference of AP_000222 with codon optimized for human cell expression
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATCCCCAGGGTTTTCATCCTGCTTACGCTTGTCGCACTGTTCTGTGCTTGCTCTACCCTGGCCGCAG
  TATCACACATCGAGGTAGATTGTATCCCGGCATTTACAGTTTACCTGCTTTATGGATTCGTCACCCTGAC
  TCTTATTTGCTCACTCATCACTGTCGTCATTGCATTCATCCAGTGTATTGACTGGGTCTGTGTCCGCTTT
  GCGTATCTGCGCCATCACCCGCAATATAGGGATCGGACCATTGCCGAATTGCTCAGGATTCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >VC100135 representing AP_000222
  Red=Cloning sites Green=Tags
  
  MIPRVFILLTLVALFCACSTLAAVSHIEVDCIPAFTVYLLYGFVTLTLICSLITVVIAFIQCIDWVCVRF
  AYLRHHPQYRDRTIAELLRIL
  
  TRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: AC_000008
• ORF Size: 273 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.

Reference Data

• RefSeq: AC_000008.1, AP_000222
• RefSeq ORF: 273
• MW: 10.4 kDa