Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 428.00
In Stock
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- IHC
Isotypes
- IgG
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (20)
- ESR1 (12)
- STAT1 (11)
- ATF2 (10)
- HDAC2 (10)
- BAD (9)
- CREB1 (9)
- RELA (9)
- BAX (8)
- CASP7 (8)
- NFKBIA (8)
- NR3C1 (8)
- PAK1 (8)
- SMAD3 (8)
- APP (7)
- BRAF (7)
- CASP3 (7)
- HSPD1 (7)
- IRS1 (7)
- JUN (7)
- JUP (7)
- PTEN (7)
- STAT3 (7)
- STAT5B (7)
- APAF1 (6)
- BCL2L1 (6)
- BCL2L11 (6)
- CASP9 (6)
- CHUK (6)
- FOS (6)
- FOXO1 (6)
- GCG (6)
- JUND (6)
- KDM1A (6)
- KDR (6)
- KRT8 (6)
- LOX (6)
- MAPK14 (6)
- RAB27A (6)
- RPS6KB1 (6)
- SGK1 (6)
- SRC (6)
- UCHL1 (6)
- VASP (6)
- ADD1 (5)
- BDNF (5)
- BIRC5 (5)
- CCNB1 (5)
- CDK6 (5)
- CIDEB (5)
- DPYSL2 (5)
- EIF2AK2 (5)
- FGFR3 (5)
- FMR1 (5)
- GDF15 (5)
- GNAS (5)
- GRIK1 (5)
- GSK3A (5)
- HDAC1 (5)
- HDAC5 (5)
- HSP90AB1 (5)
- JAK1 (5)
- JAK2 (5)
- MAP2K4 (5)
- MME (5)
- PKM (5)
- PRKCA (5)
- PRKCQ (5)
- PTK2B (5)
- PXN (5)
- RAF1 (5)
- SMAD1 (5)
- SMC1A (5)
- STK39 (5)
- TNK2 (5)
- TP53 (5)
- TRAF2 (5)
- TRPC3 (5)
- TUBA1A (5)
- ACE2 (4)
- ACO1 (4)
- ADAR (4)
- ADM (4)
- ADRA1B (4)
- AFP (4)
- AIF1 (4)
- AIFM1 (4)
- AK1 (4)
- AKR1A1 (4)
- AKR1B1 (4)
- ALPL (4)
- AMD1 (4)
- ANAPC1 (4)
- ANP32A (4)
- ARRB1 (4)
- ATG5 (4)
- ATP7B (4)
- BCAR1 (4)
- BECN1 (4)
- BIRC6 (4)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (596)
- Metabolic pathways (377)
- MAPK signaling pathway (369)
- Focal adhesion (313)
- Chemokine signaling pathway (265)
- Neurotrophin signaling pathway (258)
- Prostate cancer (227)
- Neuroactive ligand-receptor interaction (218)
- Cytokine-cytokine receptor interaction (215)
- Regulation of actin cytoskeleton (214)
- Colorectal cancer (212)
- Chronic myeloid leukemia (211)
- Pancreatic cancer (211)
- Apoptosis (202)
- ErbB signaling pathway (200)
- Cell cycle (197)
- T cell receptor signaling pathway (197)
- Insulin signaling pathway (196)
- Toll-like receptor signaling pathway (188)
- Jak-STAT signaling pathway (184)
- Small cell lung cancer (179)
- Wnt signaling pathway (178)
- Progesterone-mediated oocyte maturation (164)
- Adipocytokine signaling pathway (163)
- Acute myeloid leukemia (154)
- Calcium signaling pathway (148)
- B cell receptor signaling pathway (144)
- Endometrial cancer (143)
- Alzheimer's disease (142)
- Renal cell carcinoma (140)
- Fc gamma R-mediated phagocytosis (139)
- Melanoma (139)
- Leukocyte transendothelial migration (138)
- Glioma (137)
- Endocytosis (135)
- Non-small cell lung cancer (135)
- Oocyte meiosis (133)
- VEGF signaling pathway (133)
- Natural killer cell mediated cytotoxicity (131)
- Axon guidance (130)
- GnRH signaling pathway (129)
- p53 signaling pathway (125)
- Huntington's disease (119)
- Adherens junction (118)
- Melanogenesis (117)
- TGF-beta signaling pathway (117)
- Fc epsilon RI signaling pathway (113)
- Vascular smooth muscle contraction (113)
- Gap junction (112)
- Tight junction (106)
- Amyotrophic lateral sclerosis (ALS) (105)
- Epithelial cell signaling in Helicobacter pylori infection (105)
- Long-term potentiation (98)
- NOD-like receptor signaling pathway (98)
- Bladder cancer (96)
- mTOR signaling pathway (94)
- Ubiquitin mediated proteolysis (88)
- RIG-I-like receptor signaling pathway (86)
- Long-term depression (78)
- Type II diabetes mellitus (78)
- Dilated cardiomyopathy (71)
- ECM-receptor interaction (68)
- Cell adhesion molecules (CAMs) (64)
- Purine metabolism (64)
- Glycolysis / Gluconeogenesis (63)
- Pathogenic Escherichia coli infection (62)
- Hypertrophic cardiomyopathy (HCM) (61)
- Basal cell carcinoma (60)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (59)
- Parkinson's disease (57)
- Hematopoietic cell lineage (56)
- Cytosolic DNA-sensing pathway (52)
- Thyroid cancer (52)
- Notch signaling pathway (50)
- Complement and coagulation cascades (48)
- PPAR signaling pathway (48)
- Phosphatidylinositol signaling system (47)
- Viral myocarditis (47)
- Hedgehog signaling pathway (44)
- Lysosome (42)
- Antigen processing and presentation (41)
- Prion diseases (41)
- Metabolism of xenobiotics by cytochrome P450 (38)
- ABC transporters (36)
- Base excision repair (34)
- Drug metabolism - cytochrome P450 (34)
- Vibrio cholerae infection (33)
- Inositol phosphate metabolism (32)
- Type I diabetes mellitus (31)
- Tyrosine metabolism (31)
- Fructose and mannose metabolism (29)
- Primary immunodeficiency (29)
- Pyruvate metabolism (28)
- Retinol metabolism (28)
- Arginine and proline metabolism (27)
- Dorso-ventral axis formation (27)
- Regulation of autophagy (26)
- Pyrimidine metabolism (25)
- Valine (25)
- Butanoate metabolism (24)
- Fatty acid metabolism (24)
- Glycerolipid metabolism (24)
- Nucleotide excision repair (24)
- Alanine (23)
- aspartate and glutamate metabolism (23)
- Galactose metabolism (22)
- Homologous recombination (22)
- Renin-angiotensin system (22)
- Taste transduction (22)
- DNA replication (21)
- Mismatch repair (21)
- Olfactory transduction (21)
- Arachidonic acid metabolism (20)
- Citrate cycle (TCA cycle) (20)
- Cysteine and methionine metabolism (20)
- Tryptophan metabolism (20)
- leucine and isoleucine degradation (20)
- Glutathione metabolism (18)
- Non-homologous end-joining (18)
- Proteasome (18)
- Starch and sucrose metabolism (18)
- Autoimmune thyroid disease (17)
- SNARE interactions in vesicular transport (17)
- Sphingolipid metabolism (17)
- Cardiac muscle contraction (16)
- Histidine metabolism (16)
- Pentose phosphate pathway (16)
- Systemic lupus erythematosus (16)
- Allograft rejection (15)
- Amino sugar and nucleotide sugar metabolism (15)
- Glycerophospholipid metabolism (15)
- Maturity onset diabetes of the young (15)
- Androgen and estrogen metabolism (13)
- Drug metabolism - other enzymes (13)
- Graft-versus-host disease (13)
- Phenylalanine metabolism (13)
- Linoleic acid metabolism (12)
- Oxidative phosphorylation (12)
- Propanoate metabolism (12)
- Porphyrin and chlorophyll metabolism (11)
- RNA degradation (11)
- beta-Alanine metabolism (11)
- Folate biosynthesis (10)
- Primary bile acid biosynthesis (10)
- Nitrogen metabolism (9)
- Nicotinate and nicotinamide metabolism (8)
- Taurine and hypotaurine metabolism (8)
- leucine and isoleucine biosynthesis (8)
- Ether lipid metabolism (7)
- Glycine (7)
- Lysine degradation (7)
- Pentose and glucuronate interconversions (7)
- Ribosome (7)
- serine and threonine metabolism (7)
- Glycosaminoglycan degradation (6)
- Methane metabolism (6)
- Pantothenate and CoA biosynthesis (6)
- Ascorbate and aldarate metabolism (5)
- Asthma (5)
- Circadian rhythm - mammal (5)
- Fatty acid biosynthesis (5)
- Glyoxylate and dicarboxylate metabolism (5)
- Riboflavin metabolism (5)
- Basal transcription factors (4)
- C21-Steroid hormone metabolism (4)
- Other glycan degradation (4)
- Selenoamino acid metabolism (4)
- Steroid biosynthesis (4)
- Synthesis and degradation of ketone bodies (4)
- Aminoacyl-tRNA biosynthesis (3)
- Biosynthesis of unsaturated fatty acids (3)
- Limonene and pinene degradation (3)
- O-Glycan biosynthesis (3)
- Spliceosome (3)
- Terpenoid backbone biosynthesis (3)
- alpha-Linolenic acid metabolism (3)
- Caffeine metabolism (2)
- N-Glycan biosynthesis (2)
- One carbon pool by folate (2)
- Sulfur metabolism (2)
- Vitamin B6 metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Heparan sulfate biosynthesis (1)
- Phenylalanine (1)
- RNA polymerase (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)