14.1 kDa protein (NC_012959) Virus Tagged ORF Clone
CAT#: VC100178
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for 141 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038629
View other clones from "Virus" (35)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | 14.1 kDa protein |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100178 represents NCBI reference of YP_003038629 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTCTGCCCATCCTGCCCCCACCTCCACTTAACGATAGGCAGGGCTCCATCAATTGGATGGGAATGG CCTACAGGGTCCTCGCCGACGTTCTTAGAGGAATCCGGATGGACGGTCTGTTTGTGAGCTCCGACACCGA GGAACTCCTGCACAATCTGTGGGAGTGGATGTACTTTAGTTGGATGGTGGAAAGGCAACAGAGGAAGGAT GGCCGCCGGAGGGGCATTTGCTGCTCACGAGCTACCTTCTGTTGGCAGAAATATAATGAGGTTAGAAAGC GCGTGCACTATAATGAACATCGGGGAACAATTGACCTCGCTCCCCCTAGTTCCATCAGCCAAGGTCCTTT TATTACCATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100178 representing YP_003038629
Red=Cloning sites Green=Tags MVLPILPPPPLNDRQGSINWMGMAYRVLADVLRGIRMDGLFVSSDTEELLHNLWEWMYFSWMVERQQRKD GRRRGICCSRATFCWQKYNEVRKRVHYNEHRGTIDLAPPSSISQGPFITI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_012959 |
ORF Size | 360 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_012959.1, YP_003038629 |
RefSeq ORF | 360 |
MW | 14.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100146 | Myc-DDK-tagged ORF clone of viral ORF for early E1A 13s [Human adenovirus 54], codon optimized for human cell expression, YP_003038597 |
USD 400.00 |
|
VC100147 | Myc-DDK-tagged ORF clone of viral ORF for Early E1A 12s [Human adenovirus 54], codon optimized for human cell expression, YP_003038598 |
USD 400.00 |
|
VC100148 | Myc-DDK-tagged ORF clone of viral ORF for E1B 211 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038599 |
USD 400.00 |
|
VC100149 | Myc-DDK-tagged ORF clone of viral ORF for E1B 55 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038600 |
USD 630.00 |
|
VC100150 | Myc-DDK-tagged ORF clone of viral ORF for pIX [Human adenovirus 54], codon optimized for human cell expression, YP_003038601 |
USD 400.00 |
|
VC100151 | Myc-DDK-tagged ORF clone of viral ORF for pIVa2 [Human adenovirus 54], codon optimized for human cell expression, YP_003038602 |
USD 580.00 |
|
VC100152 | Myc-DDK-tagged ORF clone of viral ORF for polymerase [Human adenovirus 54], codon optimized for human cell expression, YP_003038603 |
USD 1,740.00 |
|
VC100153 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 54], codon optimized for human cell expression, YP_003038604 |
USD 800.00 |
|
VC100154 | Myc-DDK-tagged ORF clone of viral ORF for 52/55K [Human adenovirus 54], codon optimized for human cell expression, YP_003038605 |
USD 470.00 |
|
VC100155 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 54], codon optimized for human cell expression, YP_003038606 |
USD 720.00 |
|
VC100156 | Myc-DDK-tagged ORF clone of viral ORF for penton [Human adenovirus 54], codon optimized for human cell expression, YP_003038607 |
USD 660.00 |
|
VC100157 | Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 54], codon optimized for human cell expression, YP_003038608 |
USD 400.00 |
|
VC100158 | Myc-DDK-tagged ORF clone of viral ORF for pV [Human adenovirus 54], codon optimized for human cell expression, YP_003038609 |
USD 400.00 |
|
VC100159 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 54], codon optimized for human cell expression, YP_003038610 |
USD 400.00 |
|
VC100160 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 54], codon optimized for human cell expression, YP_003038611 |
USD 400.00 |
|
VC100161 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 54], codon optimized for human cell expression, YP_003038612 |
USD 1,510.00 |
|
VC100162 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 54], codon optimized for human cell expression, YP_003038613 |
USD 400.00 |
|
VC100163 | Myc-DDK-tagged ORF clone of viral ORF for DNA binding protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038614 |
USD 630.00 |
|
VC100164 | Myc-DDK-tagged ORF clone of viral ORF for 802 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038615 |
USD 1,130.00 |
|
VC100165 | Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038616 |
USD 400.00 |
|
VC100166 | Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 54], codon optimized for human cell expression, YP_003038617 |
USD 400.00 |
|
VC100167 | Myc-DDK-tagged ORF clone of viral ORF for 122 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038618 |
USD 400.00 |
|
VC100168 | Myc-DDK-tagged ORF clone of viral ORF for 209 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038619 |
USD 400.00 |
|
VC100169 | Myc-DDK-tagged ORF clone of viral ORF for 176 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038620 |
USD 400.00 |
|
VC100170 | Myc-DDK-tagged ORF clone of viral ORF for 445 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038621 |
USD 540.00 |
|
VC100171 | Myc-DDK-tagged ORF clone of viral ORF for 293 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038622 |
USD 400.00 |
|
VC100172 | Myc-DDK-tagged ORF clone of viral ORF for 105 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038623 |
USD 400.00 |
|
VC100173 | Myc-DDK-tagged ORF clone of viral ORF for 142 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038624 |
USD 400.00 |
|
VC100174 | Myc-DDK-tagged ORF clone of viral ORF for 147 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038625 |
USD 400.00 |
|
VC100175 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 54], codon optimized for human cell expression, YP_003038626 |
USD 450.00 |
|
VC100176 | Myc-DDK-tagged ORF clone of viral ORF for 34 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038627 |
USD 400.00 |
|
VC100177 | Myc-DDK-tagged ORF clone of viral ORF for 85 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038628 |
USD 400.00 |
|
VC100179 | Myc-DDK-tagged ORF clone of viral ORF for 136 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038630 |
USD 400.00 |
|
VC100180 | Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038631 |
USD 400.00 |
|
VC100181 | Myc-DDK-tagged ORF clone of viral ORF for 73 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038632 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review