Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit anti-GHRH Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GHRH |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Rabbit Polyclonal Anti-MSTN Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Secreted Protein
Filter by
Target Symbol
- EGFR (30)
- EPOR (7)
- SPP1 (7)
- ANXA2 (6)
- GNAS (6)
- LOX (6)
- SYT1 (6)
- TIMP4 (6)
- TNFRSF1B (6)
- VEGFB (6)
- AFP (5)
- AGT (5)
- ANGPT2 (5)
- CALR (5)
- CRP (5)
- DKK3 (5)
- EPHA3 (5)
- FGF4 (5)
- MUC1 (5)
- SERPINB5 (5)
- STX1A (5)
- TNFSF13 (5)
- VEGFA (5)
- ACE (4)
- ADIPOQ (4)
- AMPH (4)
- CXCL12 (4)
- DCN (4)
- EDA (4)
- FGF2 (4)
- GABBR1 (4)
- GDF15 (4)
- IL1RL1 (4)
- IL20 (4)
- INHBA (4)
- NGF (4)
- NRG1 (4)
- SERPINC1 (4)
- TGFB1 (4)
- TGFB2 (4)
- TIMP2 (4)
- VASH1 (4)
- WNT3A (4)
- ADCK1 (3)
- AGER (3)
- AGR2 (3)
- ANGPTL3 (3)
- B2M (3)
- BDNF (3)
- C1QTNF2 (3)
- C1QTNF7 (3)
- CALCA (3)
- CCL17 (3)
- CD40 (3)
- CD5L (3)
- CLU (3)
- CSF2RA (3)
- DKK2 (3)
- EPO (3)
- F9 (3)
- FGB (3)
- GAST (3)
- HPSE (3)
- IGF1 (3)
- IGFBP3 (3)
- IL15RA (3)
- IL16 (3)
- IL1B (3)
- LAMB1 (3)
- LGALS3 (3)
- LY96 (3)
- METRN (3)
- MMP23B (3)
- OLR1 (3)
- PGF (3)
- PLTP (3)
- SERPINF1 (3)
- SYT5 (3)
- TIMP3 (3)
- TNFRSF11B (3)
- VGF (3)
- WNT1 (3)
- WNT10A (3)
- WNT10B (3)
- A1BG (2)
- ACE2 (2)
- ADAM9 (2)
- ADAMTS18 (2)
- ADAMTSL2 (2)
- ADM (2)
- AMBP (2)
- AMY1A (2)
- ANGPT1 (2)
- ANGPTL4 (2)
- APCS (2)
- APOE (2)
- APOH (2)
- APOM (2)
- BGN (2)
- BMP2 (2)
Clonalities
Modifications
Pathways
- Cytokine-cytokine receptor interaction (172)
- Pathways in cancer (133)
- MAPK signaling pathway (78)
- Focal adhesion (77)
- Pancreatic cancer (59)
- Regulation of actin cytoskeleton (57)
- Melanoma (52)
- Bladder cancer (48)
- Jak-STAT signaling pathway (48)
- Complement and coagulation cascades (42)
- GnRH signaling pathway (41)
- Colorectal cancer (40)
- Endocytosis (39)
- Prostate cancer (39)
- TGF-beta signaling pathway (39)
- ErbB signaling pathway (38)
- Calcium signaling pathway (37)
- Gap junction (36)
- Glioma (35)
- Hedgehog signaling pathway (35)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- Melanogenesis (33)
- Wnt signaling pathway (33)
- Non-small cell lung cancer (32)
- Basal cell carcinoma (31)
- Adherens junction (30)
- Dorso-ventral axis formation (30)
- Endometrial cancer (30)
- Renal cell carcinoma (29)
- Hematopoietic cell lineage (27)
- ECM-receptor interaction (26)
- Toll-like receptor signaling pathway (22)
- mTOR signaling pathway (21)
- Chemokine signaling pathway (20)
- Dilated cardiomyopathy (19)
- Hypertrophic cardiomyopathy (HCM) (17)
- Axon guidance (16)
- Metabolic pathways (16)
- p53 signaling pathway (15)
- Apoptosis (14)
- Neuroactive ligand-receptor interaction (14)
- Autoimmune thyroid disease (13)
- PPAR signaling pathway (13)
- Renin-angiotensin system (13)
- Type I diabetes mellitus (13)
- Adipocytokine signaling pathway (12)
- Allograft rejection (12)
- Cell cycle (12)
- Long-term depression (11)
- Small cell lung cancer (11)
- Alzheimer's disease (10)
- Antigen processing and presentation (10)
- Chronic myeloid leukemia (10)
- Asthma (9)
- Cytosolic DNA-sensing pathway (9)
- Graft-versus-host disease (9)
- NOD-like receptor signaling pathway (9)
- Neurotrophin signaling pathway (9)
- Prion diseases (8)
- SNARE interactions in vesicular transport (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Natural killer cell mediated cytotoxicity (7)
- Vascular smooth muscle contraction (7)
- RIG-I-like receptor signaling pathway (6)
- Systemic lupus erythematosus (6)
- T cell receptor signaling pathway (6)
- Taste transduction (6)
- VEGF signaling pathway (6)
- Vibrio cholerae infection (6)
- Cell adhesion molecules (CAMs) (5)
- Fc epsilon RI signaling pathway (5)
- Fc gamma R-mediated phagocytosis (5)
- Primary immunodeficiency (5)
- Type II diabetes mellitus (5)
- Leukocyte transendothelial migration (4)
- Oocyte meiosis (4)
- Progesterone-mediated oocyte maturation (4)
- Regulation of autophagy (4)
- Viral myocarditis (4)
- Glycosaminoglycan degradation (3)
- Huntington's disease (3)
- Pathogenic Escherichia coli infection (3)
- Starch and sucrose metabolism (3)
- Acute myeloid leukemia (2)
- Glycerolipid metabolism (2)
- Maturity onset diabetes of the young (2)
- Tyrosine metabolism (2)
- Arachidonic acid metabolism (1)
- Ether lipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Histidine metabolism (1)
- Insulin signaling pathway (1)
- Linoleic acid metabolism (1)
- N-Glycan biosynthesis (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Proteasome (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- alpha-Linolenic acid metabolism (1)
- beta-Alanine metabolism (1)