UL6 (NC_006273) Virus Tagged ORF Clone
CAT#: VC101198
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081466
View other clones from "Virus" (142)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | UL6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101198 represents NCBI reference of YP_081466 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACGGTTGGGCTGGCGTCTGCCTCATCACACACTGTCTCAACACTCGCTCCAGAACCTATGTCGCCC TCAACATGCTCGCTTTCGCAAGAACCCCACGCGGCGTCCCAAGTTGCCTCTTCAACAAGGTCTGGGTTTC CAGGTATGCATTGGTCCTCATTCTTATGGTGTGTGCATCAGAGAGCTCAACCTCTTGGGCCGTGACTTCC AACGGGCTGCCTAATTGTTCCACTGTTACCCGAACAGCAGGACAGGACGCAGAATTGCACGGTCCAGCCC CTCTGTCCTGCAATGTGACCCAATGGGGCAGGTACGAGAACGGGAGCACACCAGTGCTCTGGTGTACACT CAGGGGATCCCGGATGAGGGTGTCTCTTGGTCACCGGGTGGCCTTCGGATGTAGCTGGAAGACCTTTTTC ATTTACAATGTCTCAGAAAGCTCCGGGGGTACCTACTATCAGAAGGGATACAATTGTACCGATAAACACA TTACCCTGTCTTGTTTCAACCTGACCGTTGTCCCTCGGGCCGTTCAGAGTACCACAACTGTTATGACACC AACCCTGGTAACCAACTCAACTTTCAGCGTCTCATTGGTGGCTCTGAGGCTTACCACCAATTCTTCTGCA TTTGGTCATGCTATCTATCAACGGCAGCAGCGGGTAGAAAATGGCACCCTCTCAAAAAACATCACCAACC TTGCTTTTACTTACGGATCATGGGGGGTCGCAATGCTCCTTTTCGCCGCTGTCATGGTTCTGGTCGACCT CGGGTTGCCACAGAGTGCGTGGAGAAGGTGGCGGTCACATGTGGATGACGAGGAACGGGGGCTGCTGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101198 representing YP_081466
Red=Cloning sites Green=Tags MNGWAGVCLITHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILMVCASESSTSWAVTS NGLPNCSTVTRTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCTLRGSRMRVSLGHRVAFGCSWKTFF IYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPRAVQSTTTVMTPTLVTNSTFSVSLVALRLTTNSSA FGHAIYQRQQRVENGTLSKNITNLAFTYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_006273 |
ORF Size | 840 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_006273.2, YP_081466 |
RefSeq ORF | 840 |
Locus ID | 3077507 |
MW | 30.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101187 | Myc-DDK-tagged ORF clone of viral ORF for protein RL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081455 |
USD 400.00 |
|
VC101188 | Myc-DDK-tagged ORF clone of viral ORF for protein RL5A [Human herpesvirus 5], codon optimized for human cell expression, YP_081456 |
USD 400.00 |
|
VC101189 | Myc-DDK-tagged ORF clone of viral ORF for protein RL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081457 |
USD 400.00 |
|
VC101190 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein RL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081458 |
USD 400.00 |
|
VC101191 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein RL11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081459 |
USD 400.00 |
|
VC101192 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081460 |
USD 540.00 |
|
VC101193 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081461 |
USD 400.00 |
|
VC101194 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081462 |
USD 400.00 |
|
VC101195 | Myc-DDK-tagged ORF clone of viral ORF for protein UL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081463 |
USD 400.00 |
|
VC101196 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL4 [Human herpesvirus 5], codon optimized for human cell expression, YP_081464 |
USD 400.00 |
|
VC101197 | Myc-DDK-tagged ORF clone of viral ORF for protein UL5 [Human herpesvirus 5], codon optimized for human cell expression, YP_081465 |
USD 400.00 |
|
VC101199 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081467 |
USD 400.00 |
|
VC101200 | Myc-DDK-tagged ORF clone of viral ORF for protein UL8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081468 |
USD 400.00 |
|
VC101201 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081469 |
USD 400.00 |
|
VC101202 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081470 |
USD 400.00 |
|
VC101204 | Myc-DDK-tagged ORF clone of viral ORF for protein UL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081472 |
USD 610.00 |
|
VC101205 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081473 |
USD 400.00 |
|
VC101206 | Myc-DDK-tagged ORF clone of viral ORF for protein UL15A [Human herpesvirus 5], codon optimized for human cell expression, YP_081474 |
USD 400.00 |
|
VC101207 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081475 |
USD 400.00 |
|
VC101208 | Myc-DDK-tagged ORF clone of viral ORF for protein UL17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081476 |
USD 400.00 |
|
VC101209 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081477 |
USD 460.00 |
|
VC101210 | Myc-DDK-tagged ORF clone of viral ORF for protein UL19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081478 |
USD 400.00 |
|
VC101211 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081479 |
USD 430.00 |
|
VC101212 | Myc-DDK-tagged ORF clone of viral ORF for protein UL21A [Human herpesvirus 5], codon optimized for human cell expression, YP_081480 |
USD 400.00 |
|
VC101213 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein UL22A [Human herpesvirus 5], codon optimized for human cell expression, YP_081481 |
USD 400.00 |
|
VC101214 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081482 |
USD 400.00 |
|
VC101215 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 5], codon optimized for human cell expression, YP_081483 |
USD 400.00 |
|
VC101216 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL25 [Human herpesvirus 5], codon optimized for human cell expression, YP_081484 |
USD 830.00 |
|
VC101217 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081485 |
USD 400.00 |
|
VC101218 | Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081486 |
USD 770.00 |
|
VC101219 | Myc-DDK-tagged ORF clone of viral ORF for protein UL29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081487 |
USD 1,110.00 |
|
VC101220 | Myc-DDK-tagged ORF clone of viral ORF for protein UL30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081489 |
USD 400.00 |
|
VC101221 | Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081490 |
USD 750.00 |
|
VC101222 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081491 |
USD 1,670.00 |
|
VC101223 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081492 |
USD 520.00 |
|
VC101224 | Myc-DDK-tagged ORF clone of viral ORF for protein UL34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081493 |
USD 520.00 |
|
VC101225 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 5], codon optimized for human cell expression, YP_081494 |
USD 810.00 |
|
VC101226 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 5], codon optimized for human cell expression, YP_081495 |
USD 610.00 |
|
VC101227 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081496 |
USD 630.00 |
|
VC101228 | Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 5], codon optimized for human cell expression, YP_081497 |
USD 400.00 |
|
VC101229 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL40 [Human herpesvirus 5], codon optimized for human cell expression, YP_081498 |
USD 400.00 |
|
VC101230 | Myc-DDK-tagged ORF clone of viral ORF for protein UL41A [Human herpesvirus 5], codon optimized for human cell expression, YP_081499 |
USD 400.00 |
|
VC101231 | Myc-DDK-tagged ORF clone of viral ORF for protein UL42 [Human herpesvirus 5], codon optimized for human cell expression, YP_081500 |
USD 400.00 |
|
VC101232 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 5], codon optimized for human cell expression, YP_081501 |
USD 550.00 |
|
VC101233 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081502 |
USD 560.00 |
|
VC101234 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081503 |
USD 1,440.00 |
|
VC101235 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081504 |
USD 400.00 |
|
VC101236 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081505 |
USD 1,560.00 |
|
VC101238 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081507 |
USD 400.00 |
|
VC101239 | Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 5], codon optimized for human cell expression, YP_081508 |
USD 720.00 |
|
VC101240 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081509 |
USD 500.00 |
|
VC101241 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081510 |
USD 400.00 |
|
VC101242 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081511 |
USD 1,060.00 |
|
VC101243 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081512 |
USD 470.00 |
|
VC101244 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081513 |
USD 1,980.00 |
|
VC101245 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 5], codon optimized for human cell expression, YP_081514 |
USD 1,440.00 |
|
VC101246 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081515 |
USD 1,360.00 |
|
VC101248 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 5], codon optimized for human cell expression, YP_081517 |
USD 1,170.00 |
|
VC101249 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081518 |
USD 1,500.00 |
|
VC101250 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 5], codon optimized for human cell expression, YP_081519 |
USD 450.00 |
|
VC101251 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 5], codon optimized for human cell expression, YP_081520 |
USD 490.00 |
|
VC101252 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 5], codon optimized for human cell expression, YP_081521 |
USD 400.00 |
|
VC101253 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 5], codon optimized for human cell expression, YP_081522 |
USD 610.00 |
|
VC101254 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24, partial [Human herpesvirus 5], codon optimized for human cell expression, YP_002802310 |
USD 400.00 |
|
VC101255 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 5], codon optimized for human cell expression, YP_081523 |
USD 1,170.00 |
|
VC101258 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 5], codon optimized for human cell expression, YP_081526 |
USD 560.00 |
|
VC101259 | Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 5], codon optimized for human cell expression, YP_081527 |
USD 400.00 |
|
VC101262 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp71 [Human herpesvirus 5], codon optimized for human cell expression, YP_081530 |
USD 710.00 |
|
VC101263 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 5], codon optimized for human cell expression, YP_081531 |
USD 710.00 |
|
VC101264 | Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 5], codon optimized for human cell expression, YP_081532 |
USD 740.00 |
|
VC101265 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081533 |
USD 400.00 |
|
VC101267 | Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 5], codon optimized for human cell expression, YP_081535 |
USD 1,490.00 |
|
VC101268 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 5], codon optimized for human cell expression, YP_081536 |
USD 550.00 |
|
VC101269 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081537 |
USD 1,070.00 |
|
VC101270 | Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 5], codon optimized for human cell expression, YP_081538 |
USD 400.00 |
|
VC101271 | Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 5], codon optimized for human cell expression, YP_081539 |
USD 400.00 |
|
VC101273 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081541 |
USD 430.00 |
|
VC101275 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081543 |
USD 400.00 |
|
VC101276 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 5], codon optimized for human cell expression, YP_081544 |
USD 1,120.00 |
|
VC101277 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 5], codon optimized for human cell expression, YP_081545 |
USD 740.00 |
|
VC101278 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081546 |
USD 400.00 |
|
VC101279 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 5], codon optimized for human cell expression, YP_081547 |
USD 470.00 |
|
VC101281 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081549 |
USD 400.00 |
|
VC101282 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081550 |
USD 1,110.00 |
|
VC101284 | Myc-DDK-tagged ORF clone of viral ORF for interleukin-10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081552 |
USD 400.00 |
|
VC101286 | Myc-DDK-tagged ORF clone of viral ORF for large tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081554 |
USD 400.00 |
|
VC101287 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 5], codon optimized for human cell expression, YP_081555 |
USD 400.00 |
|
VC101291 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL120 [Human herpesvirus 5], codon optimized for human cell expression, YP_081559 |
USD 400.00 |
|
VC101292 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL121 [Human herpesvirus 5], codon optimized for human cell expression, YP_081560 |
USD 400.00 |
|
VC101293 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081561 |
USD 740.00 |
|
VC101294 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081562 |
USD 630.00 |
|
VC101295 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 5], codon optimized for human cell expression, YP_081563 |
USD 400.00 |
|
VC101296 | Myc-DDK-tagged ORF clone of viral ORF for truncated envelope protein UL128 [Human herpesvirus 5], codon optimized for human cell expression, YP_081564 |
USD 400.00 |
|
VC101297 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL130 [Human herpesvirus 5], codon optimized for human cell expression, YP_081565 |
USD 400.00 |
|
VC101298 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL131A [Human herpesvirus 5], codon optimized for human cell expression, YP_081566 |
USD 400.00 |
|
VC101299 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL132 [Human herpesvirus 5], codon optimized for human cell expression, YP_081567 |
USD 400.00 |
|
VC101300 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL148 [Human herpesvirus 5], codon optimized for human cell expression, YP_081568 |
USD 400.00 |
|
VC101301 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL147A [Human herpesvirus 5], codon optimized for human cell expression, YP_081569 |
USD 400.00 |
|
VC101302 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081570 |
USD 400.00 |
|
VC101303 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081571 |
USD 400.00 |
|
VC101304 | Myc-DDK-tagged ORF clone of viral ORF for protein UL145 [Human herpesvirus 5], codon optimized for human cell expression, YP_081572 |
USD 400.00 |
|
VC101305 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL144 [Human herpesvirus 5], codon optimized for human cell expression, YP_081573 |
USD 400.00 |
|
VC101306 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL142 [Human herpesvirus 5], codon optimized for human cell expression, YP_081574 |
USD 400.00 |
|
VC101307 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL141 [Human herpesvirus 5], codon optimized for human cell expression, YP_081575 |
USD 430.00 |
|
VC101308 | Myc-DDK-tagged ORF clone of viral ORF for protein UL140 [Human herpesvirus 5], codon optimized for human cell expression, YP_081576 |
USD 400.00 |
|
VC101309 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL139 [Human herpesvirus 5], codon optimized for human cell expression, YP_081577 |
USD 400.00 |
|
VC101310 | Myc-DDK-tagged ORF clone of viral ORF for protein UL138 [Human herpesvirus 5], codon optimized for human cell expression, YP_081578 |
USD 400.00 |
|
VC101312 | Myc-DDK-tagged ORF clone of viral ORF for protein UL135 [Human herpesvirus 5], codon optimized for human cell expression, YP_081580 |
USD 400.00 |
|
VC101314 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148A [Human herpesvirus 5], codon optimized for human cell expression, YP_081582 |
USD 400.00 |
|
VC101315 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148B [Human herpesvirus 5], codon optimized for human cell expression, YP_081583 |
USD 400.00 |
|
VC101316 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148C [Human herpesvirus 5], codon optimized for human cell expression, YP_081584 |
USD 400.00 |
|
VC101317 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148D [Human herpesvirus 5], codon optimized for human cell expression, YP_081585 |
USD 400.00 |
|
VC101318 | Myc-DDK-tagged ORF clone of viral ORF for protein UL150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081586 |
USD 810.00 |
|
VC101321 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081589 |
USD 400.00 |
|
VC101322 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US3 [Human herpesvirus 5], codon optimized for human cell expression, YP_081590 |
USD 400.00 |
|
VC101323 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081591 |
USD 400.00 |
|
VC101324 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081592 |
USD 400.00 |
|
VC101325 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081593 |
USD 400.00 |
|
VC101326 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081594 |
USD 400.00 |
|
VC101327 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081595 |
USD 400.00 |
|
VC101328 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081596 |
USD 400.00 |
|
VC101329 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081597 |
USD 400.00 |
|
VC101330 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081598 |
USD 400.00 |
|
VC101331 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081599 |
USD 400.00 |
|
VC101332 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US15 [Human herpesvirus 5], codon optimized for human cell expression, YP_081600 |
USD 400.00 |
|
VC101333 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081601 |
USD 400.00 |
|
VC101334 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081602 |
USD 400.00 |
|
VC101335 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081603 |
USD 400.00 |
|
VC101336 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081604 |
USD 400.00 |
|
VC101337 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081605 |
USD 400.00 |
|
VC101338 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US21 [Human herpesvirus 5], codon optimized for human cell expression, YP_081606 |
USD 400.00 |
|
VC101339 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein US22 [Human herpesvirus 5], codon optimized for human cell expression, YP_081607 |
USD 730.00 |
|
VC101340 | Myc-DDK-tagged ORF clone of viral ORF for protein US23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081608 |
USD 750.00 |
|
VC101342 | Myc-DDK-tagged ORF clone of viral ORF for protein US26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081610 |
USD 760.00 |
|
VC101343 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein US27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081611 |
USD 460.00 |
|
VC101344 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein US28 [Human herpesvirus 5], codon optimized for human cell expression, YP_081612 |
USD 440.00 |
|
VC101345 | Myc-DDK-tagged ORF clone of viral ORF for protein US29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081613 |
USD 590.00 |
|
VC101346 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081614 |
USD 440.00 |
|
VC101347 | Myc-DDK-tagged ORF clone of viral ORF for protein US31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081615 |
USD 400.00 |
|
VC101348 | Myc-DDK-tagged ORF clone of viral ORF for protein US32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081616 |
USD 400.00 |
|
VC101349 | Myc-DDK-tagged ORF clone of viral ORF for protein US34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081617 |
USD 400.00 |
|
VC101350 | Myc-DDK-tagged ORF clone of viral ORF for protein US34A [Human herpesvirus 5], codon optimized for human cell expression, YP_081618 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review