U75 (NC_000898) Virus Tagged ORF Clone
CAT#: VC101514
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp080 [Human herpesvirus 6], codon optimized for human cell expression, NP_050254
"NC_000898" in other vectors (98)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | U75 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101514 represents NCBI reference of NP_050254 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAATCCTTGAAGAAACTGAAGGAACTCGAAACAAGCGATGTTTTCAACACTCTGCACGTCCGAACAA TCCTGAAAGTCATCAAAATAGATAAGTGCGTGTCTCTTGCTCGACATTCTTTGGTGAACATTACGGTTGG AGATGACGGTATTTGGTTCCACTTGGAGGACGGGACAATGATTAATGGCTTGGAGTACAAGACTATCTGC GAAAAAGAGCTGGGGTTTCAAGGATTTATTGGCATCATTATCTTGGATTCCGAGGATACCCTGCAGGAAC TGCGCCTGAACCCATTCCAATTCAAGAGGCGGCTTATCCATATGAAGGTGGATACCCCCGAAGAATTTAT GCTCTGTGGTCTGGTCTTTGCCCTGGAGAACCTGCCCCTTAAGCAGTCAACGCTGCATAAGCTTATCGCT AGACTCGTCCTGTTTCCTGTCTTGTCACCTGTGACAAAAATCTTGTTTAATACCTGCGATAAACTGGTGT GTACCCTCAGGCACATTTTTTTTAATGAACACGCTAGCGAGATTCTTCACAAGGTTCCGCCCATGATTAG GCTGTACAATGAGATGAAGAATACACACATTGAAGTGTTGGAGCTGTATTTCAACACGAAGCGATCCCAT AACTTCATAAACCTCAGCCTGGAGTCCCGCCAGCTCCAGGATAGTTCCCTCCAGGTAATTCAACTGGCTA CCCAGTTCGCTCAGATTTTCTATTCCAAAAATGAAGATACCTCATCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101514 representing NP_050254
Red=Cloning sites Green=Tags MKSLKKLKELETSDVFNTLHVRTILKVIKIDKCVSLARHSLVNITVGDDGIWFHLEDGTMINGLEYKTIC EKELGFQGFIGIIILDSEDTLQELRLNPFQFKRRLIHMKVDTPEEFMLCGLVFALENLPLKQSTLHKLIA RLVLFPVLSPVTKILFNTCDKLVCTLRHIFFNEHASEILHKVPPMIRLYNEMKNTHIEVLELYFNTKRSH NFINLSLESRQLQDSSLQVIQLATQFAQIFYSKNEDTSS TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_000898 |
ORF Size | 747 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_000898.1, NP_050254 |
RefSeq ORF | 747 |
Locus ID | 1497075 |
MW | 28.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101440 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Human herpesvirus 6], codon optimized for human cell expression, NP_050176 |
USD 1,210.00 |
|
VC101441 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050180 |
USD 490.00 |
|
VC101442 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp004 [Human herpesvirus 6], codon optimized for human cell expression, NP_050179 |
USD 400.00 |
|
VC101443 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp003 [Human herpesvirus 6], codon optimized for human cell expression, NP_050178 |
USD 400.00 |
|
VC101444 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp002 [Human herpesvirus 6], codon optimized for human cell expression, NP_050177 |
USD 400.00 |
|
VC101445 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp006 [Human herpesvirus 6], codon optimized for human cell expression, NP_050181 |
USD 400.00 |
|
VC101447 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050183 |
USD 400.00 |
|
VC101448 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050185 |
USD 480.00 |
|
VC101449 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp009 [Human herpesvirus 6], codon optimized for human cell expression, NP_050186 |
USD 680.00 |
|
VC101450 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp014 [Human herpesvirus 6], codon optimized for human cell expression, NP_050188 |
USD 400.00 |
|
VC101451 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp012 [Human herpesvirus 6], codon optimized for human cell expression, NP_050189 |
USD 520.00 |
|
VC101452 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp015 [Human herpesvirus 6], codon optimized for human cell expression, NP_050190 |
USD 400.00 |
|
VC101453 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp016 [Human herpesvirus 6], codon optimized for human cell expression, NP_050191 |
USD 640.00 |
|
VC101454 | Myc-DDK-tagged ORF clone of viral ORF for antigenic virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050192 |
USD 1,370.00 |
|
VC101455 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp019 [Human herpesvirus 6], codon optimized for human cell expression, NP_050194 |
USD 400.00 |
|
VC101456 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp020 [Human herpesvirus 6], codon optimized for human cell expression, NP_050195 |
USD 770.00 |
|
VC101457 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 6 [Human herpesvirus 6], codon optimized for human cell expression, NP_050198 |
USD 400.00 |
|
VC101458 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 4 [Human herpesvirus 6], codon optimized for human cell expression, NP_050199 |
USD 490.00 |
|
VC101459 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050200 |
USD 560.00 |
|
VC101460 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050201 |
USD 640.00 |
|
VC101461 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp013 [Human herpesvirus 6], codon optimized for human cell expression, NP_050187 |
USD 1,430.00 |
|
VC101462 | Myc-DDK-tagged ORF clone of viral ORF for transcription regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_050197 |
USD 420.00 |
|
VC101463 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050202 |
USD 400.00 |
|
VC101464 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp027 [Human herpesvirus 6], codon optimized for human cell expression, NP_050204 |
USD 400.00 |
|
VC101465 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp026 [Human herpesvirus 6], codon optimized for human cell expression, NP_050205 |
USD 400.00 |
|
VC101466 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp025 [Human herpesvirus 6], codon optimized for human cell expression, NP_050206 |
USD 400.00 |
|
VC101467 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp033 [Human herpesvirus 6], codon optimized for human cell expression, NP_050207 |
USD 400.00 |
|
VC101468 | Myc-DDK-tagged ORF clone of viral ORF for Polymerase processivity factor [Human herpesvirus 6], codon optimized for human cell expression, NP_050208 |
USD 460.00 |
|
VC101469 | Myc-DDK-tagged ORF clone of viral ORF for large ribonuclease reductase [Human herpesvirus 6], codon optimized for human cell expression, NP_050209 |
USD 1,290.00 |
|
VC101470 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly and DNA maturation [Human herpesvirus 6], codon optimized for human cell expression, NP_050210 |
USD 400.00 |
|
VC101471 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050211 |
USD 1,720.00 |
|
VC101473 | Myc-DDK-tagged ORF clone of viral ORF for putative capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050213 |
USD 400.00 |
|
VC101474 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050214 |
USD 600.00 |
|
VC101475 | Myc-DDK-tagged ORF clone of viral ORF for putative virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050215 |
USD 400.00 |
|
VC101476 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp038 [Human herpesvirus 6], codon optimized for human cell expression, NP_050216 |
USD 400.00 |
|
VC101477 | Myc-DDK-tagged ORF clone of viral ORF for virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050217 |
USD 620.00 |
|
VC101478 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp043 [Human herpesvirus 6], codon optimized for human cell expression, NP_050218 |
USD 400.00 |
|
VC101479 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050219 |
USD 1,620.00 |
|
VC101480 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_050220 |
USD 1,330.00 |
|
VC101481 | Myc-DDK-tagged ORF clone of viral ORF for transport/capsid assembly [Human herpesvirus 6], codon optimized for human cell expression, NP_050221 |
USD 1,150.00 |
|
VC101482 | Myc-DDK-tagged ORF clone of viral ORF for major DNA binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050222 |
USD 1,800.00 |
|
VC101483 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050223 |
USD 660.00 |
|
VC101484 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050224 |
USD 1,370.00 |
|
VC101485 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp050 [Human herpesvirus 6], codon optimized for human cell expression, NP_050225 |
USD 400.00 |
|
VC101486 | Myc-DDK-tagged ORF clone of viral ORF for putative dUTPase [Human herpesvirus 6], codon optimized for human cell expression, NP_050226 |
USD 470.00 |
|
VC101487 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane /secreted protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050227 |
USD 400.00 |
|
VC101488 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_050228 |
USD 1,170.00 |
|
VC101489 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_050229 |
USD 1,100.00 |
|
VC101490 | Myc-DDK-tagged ORF clone of viral ORF for putative fusion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050230 |
USD 400.00 |
|
VC101491 | Myc-DDK-tagged ORF clone of viral ORF for viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050231 |
USD 710.00 |
|
VC101492 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050232 |
USD 400.00 |
|
VC101493 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp058 [Human herpesvirus 6], codon optimized for human cell expression, NP_050233 |
USD 400.00 |
|
VC101494 | Myc-DDK-tagged ORF clone of viral ORF for proteinase [Human herpesvirus 6], codon optimized for human cell expression, NP_050234 |
USD 670.00 |
|
VC101495 | Myc-DDK-tagged ORF clone of viral ORF for virion transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050235 |
USD 590.00 |
|
VC101496 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp062 [Human herpesvirus 6], codon optimized for human cell expression, NP_050236 |
USD 630.00 |
|
VC101497 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050237 |
USD 400.00 |
|
VC101498 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050238 |
USD 2,140.00 |
|
VC101499 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp064 [Human herpesvirus 6], codon optimized for human cell expression, NP_050239 |
USD 1,230.00 |
|
VC101500 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp065 [Human herpesvirus 6], codon optimized for human cell expression, NP_050240 |
USD 440.00 |
|
VC101501 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp067 [Human herpesvirus 6], codon optimized for human cell expression, NP_050242 |
USD 400.00 |
|
VC101502 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp068 [Human herpesvirus 6], codon optimized for human cell expression, NP_050243 |
USD 400.00 |
|
VC101503 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050244 |
USD 570.00 |
|
VC101504 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050245 |
USD 420.00 |
|
VC101505 | Myc-DDK-tagged ORF clone of viral ORF for Putative terminase [Human herpesvirus 6], codon optimized for human cell expression, NP_050241 |
USD 840.00 |
|
VC101506 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp071 [Human herpesvirus 6], codon optimized for human cell expression, NP_050246 |
USD 440.00 |
|
VC101507 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp072 [Human herpesvirus 6], codon optimized for human cell expression, NP_050247 |
USD 400.00 |
|
VC101508 | Myc-DDK-tagged ORF clone of viral ORF for Phosphotransferase [Human herpesvirus 6], codon optimized for human cell expression, NP_050248 |
USD 720.00 |
|
VC101509 | Myc-DDK-tagged ORF clone of viral ORF for Alkaline exonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_050249 |
USD 630.00 |
|
VC101510 | Myc-DDK-tagged ORF clone of viral ORF for Myristylated virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050250 |
USD 400.00 |
|
VC101511 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_050251 |
USD 430.00 |
|
VC101512 | Myc-DDK-tagged ORF clone of viral ORF for origin binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050252 |
USD 1,250.00 |
|
VC101513 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050253 |
USD 830.00 |
|
VC101515 | Myc-DDK-tagged ORF clone of viral ORF for putative viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050255 |
USD 830.00 |
|
VC101516 | Myc-DDK-tagged ORF clone of viral ORF for Helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050256 |
USD 1,320.00 |
|
VC101517 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp082 [Human herpesvirus 6], codon optimized for human cell expression, NP_050257 |
USD 400.00 |
|
VC101518 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp083 [Human herpesvirus 6], codon optimized for human cell expression, NP_050258 |
USD 400.00 |
|
VC101519 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication [Human herpesvirus 6], codon optimized for human cell expression, NP_050259 |
USD 620.00 |
|
VC101520 | Myc-DDK-tagged ORF clone of viral ORF for Uracyl-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_050260 |
USD 400.00 |
|
VC101521 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_050261 |
USD 400.00 |
|
VC101522 | Myc-DDK-tagged ORF clone of viral ORF for Intercrine cytokine [Human herpesvirus 6], codon optimized for human cell expression, NP_050262 |
USD 400.00 |
|
VC101523 | Myc-DDK-tagged ORF clone of viral ORF for putative glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050263 |
USD 430.00 |
|
VC101524 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050264 |
USD 400.00 |
|
VC101526 | Myc-DDK-tagged ORF clone of viral ORF for IE-A transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050266 |
USD 1,720.00 |
|
VC101527 | Myc-DDK-tagged ORF clone of viral ORF for probable membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050267 |
USD 400.00 |
|
VC101529 | Myc-DDK-tagged ORF clone of viral ORF for Parvovirus rep homolog [Human herpesvirus 6], codon optimized for human cell expression, NP_050269 |
USD 630.00 |
|
VC101530 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein IE2 [Human herpesvirus 6], codon optimized for human cell expression, NP_050270 |
USD 1,930.00 |
|
VC101531 | Myc-DDK-tagged ORF clone of viral ORF for spliced envelope glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050271 |
USD 780.00 |
|
VC101533 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050273 |
USD 1,210.00 |
|
VC101534 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp099 [Human herpesvirus 6], codon optimized for human cell expression, NP_050274 |
USD 400.00 |
|
VC101535 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp100 [Human herpesvirus 6], codon optimized for human cell expression, NP_050275 |
USD 400.00 |
|
VC101536 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp101 [Human herpesvirus 6], codon optimized for human cell expression, NP_050276 |
USD 400.00 |
|
VC101537 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050277 |
USD 490.00 |
|
VC101538 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp103 [Human herpesvirus 6], codon optimized for human cell expression, NP_050278 |
USD 400.00 |
|
VC101539 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050203 |
USD 400.00 |
|
VC101540 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp021 [Human herpesvirus 6], codon optimized for human cell expression, NP_050196 |
USD 400.00 |
|
VC101541 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050193 |
USD 400.00 |
|
VC101542 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050184 |
USD 460.00 |
|
VC101543 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor fragment [Human herpesvirus 6], codon optimized for human cell expression, NP_597817 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review